"BRD9" Related Products

Expand
Expand
Expand

Recombinant Human BRD9, GST-tagged

Cat.No.: BRD9-21H
Product Overview: Recombinant Human BRD9 (1 a.a. - 481 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description: Bromodomain-containing protein 9 is a protein that in humans is encoded by the BRD9 gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 79.6 kDa
AA Sequence: MKGYQSLVFNFFFLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIV ANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTAVEEPVPEVVPVQVETA KKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNT AEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDE TGVQCALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLGDSSSSVLEFMS MKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAERGGSRPSSNLSSLSNASERDQHHLGS PSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: BRD9 bromodomain containing 9 [ Homo sapiens ]
Official Symbol: BRD9
Synonyms: PRO9856; LAVS3040; bromodomain-containing protein 9; rhabdomyosarcoma antigen MU-RMS-40.8; sarcoma antigen NY-SAR-29; FLJ43530; DKFZp434D0711; DKFZp686L0539
Gene ID: 65980
mRNA Refseq: NM_001009877
Protein Refseq: NP_001009877
UniProt ID: Q9H8M2
Chromosome Location: 5p15.33
Function: lysine-acetylated histone binding; nucleic acid binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.