Recombinant Human BRD9, GST-tagged BRD9-21H

Recombinant Human BRD9, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BRD9, GST-tagged

Recombinant Human BRD9, GST-tagged

BRD9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BRD9-21H
Product Overview : Recombinant Human BRD9 (1 a.a. - 481 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : Bromodomain-containing protein 9 is a protein that in humans is encoded by the BRD9 gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 79.6 kDa
AA Sequence : MKGYQSLVFNFFFLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIV ANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTAVEEPVPEVVPVQVETA KKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNT AEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDE TGVQCALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLGDSSSSVLEFMS MKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAERGGSRPSSNLSSLSNASERDQHHLGS PSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : BRD9 bromodomain containing 9 [ Homo sapiens ]
Official Symbol : BRD9
Synonyms : PRO9856; LAVS3040; bromodomain-containing protein 9; rhabdomyosarcoma antigen MU-RMS-40.8; sarcoma antigen NY-SAR-29; FLJ43530; DKFZp434D0711; DKFZp686L0539
Gene ID : 65980
mRNA Refseq : NM_001009877
Protein Refseq : NP_001009877
UniProt ID : Q9H8M2
Chromosome Location : 5p15.33
Function : lysine-acetylated histone binding; nucleic acid binding; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy