Recombinant Human BRD9, GST-tagged
Cat.No. : | BRD9-21H |
Product Overview : | Recombinant Human BRD9 (1 a.a. - 481 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-481 a.a. |
Description : | Bromodomain-containing protein 9 is a protein that in humans is encoded by the BRD9 gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 79.6 kDa |
AA Sequence : | MKGYQSLVFNFFFLKLSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIV ANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNEDTAVEEPVPEVVPVQVETA KKSKKPSREVISCMFEPEGNACSLTDSTAEEHVLALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNT AEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDE TGVQCALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLGDSSSSVLEFMS MKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAERGGSRPSSNLSSLSNASERDQHHLGS PSRLSVGEQPDVTHDPYEFLQSPEPAASAKT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | BRD9 bromodomain containing 9 [ Homo sapiens ] |
Official Symbol | BRD9 |
Synonyms | PRO9856; LAVS3040; bromodomain-containing protein 9; rhabdomyosarcoma antigen MU-RMS-40.8; sarcoma antigen NY-SAR-29; FLJ43530; DKFZp434D0711; DKFZp686L0539 |
Gene ID | 65980 |
mRNA Refseq | NM_001009877 |
Protein Refseq | NP_001009877 |
UniProt ID | Q9H8M2 |
Chromosome Location | 5p15.33 |
Function | lysine-acetylated histone binding; nucleic acid binding; protein binding |
◆ Recombinant Proteins | ||
BRD9-21H | Recombinant Human BRD9, GST-tagged | +Inquiry |
BRD9-1908H | Recombinant Human BRD9, GST-tagged | +Inquiry |
BRD9-23H | Recombinant Human BRD9 Protein(130-259 aa), GST-tagged | +Inquiry |
BRD9-2488M | Recombinant Mouse BRD9 Protein | +Inquiry |
BRD9-10609Z | Recombinant Zebrafish BRD9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRD9-8410HCL | Recombinant Human BRD9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BRD9 Products
Required fields are marked with *
My Review for All BRD9 Products
Required fields are marked with *