Recombinant Human CD276, Fc-tagged CD276-542H

Recombinant Human CD276, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD276, Fc-tagged

Recombinant Human CD276, Fc-tagged

CD276 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD276-542H
Product Overview : The recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 - Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Inhibits anti-CD3-induced proliferation of stimulated human T cells. Binds anti-B7-H3 monoclonal antibodies, human IgG1 and rabbit IgG in a functional ELISA.
Molecular Mass : Calculated molecular mass 49.2 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation
AA Sequence : LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ GNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEAST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD276 CD276 molecule [ Homo sapiens ]
Official Symbol : CD276
Synonyms : CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;
Gene ID : 80381
mRNA Refseq : NM_001024736
Protein Refseq : NP_001019907
MIM : 605715
UniProt ID : Q5ZPR3
Chromosome Location : 15q23-q24
Pathway : Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function : protein binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy