Recombinant Human NCR3LG1, Fc-tagged NCR3LG1-546H

Recombinant Human NCR3LG1, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human NCR3LG1, Fc-tagged

Recombinant Human NCR3LG1, Fc-tagged

NCR3LG1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : NCR3LG1-546H
Product Overview : The recombinant human B7-H6-Fc fusion is expressed as a 466 amino acid protein consisting of Asp25 - Ser262 region of B7-H6 (UniProt accession #Q68D85) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Binds to its receptor NKp30/NCR3 and Induces IFN-γ secretion by NK-92 human natural killer lymphoma cells with an ED50 of 0.4 - 2.6 μg/ml.
Molecular Mass : Calculated molecular mass 52.2 kDa; estimated by SDS-PAGE under reducing condition 75-85 kDa probably due to glycosylation
AA Sequence : DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPW RLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEA INITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLT AARHSLSETEKTDNFSSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : NCR3LG1 natural killer cell cytotoxicity receptor 3 ligand 1 [ Homo sapiens ]
Official Symbol : NCR3LG1
Synonyms : B7H6; B7-H6; DKFZp686O24166; DKFZp686I21167; natural cytotoxicity triggering receptor 3 ligand 1; B7 homolog 6; putative Ig-like domain-containing protein DKFZp686O24166/DKFZp686I21167
Gene ID : 374383
mRNA Refseq : NM_001202439
Protein Refseq : NP_001189368
MIM : 613714
UniProt ID : Q68D85
Chromosome Location : 11p15.1
Function : structural molecule activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy