"HHLA2" Related Products

Expand
Expand

Recombinant Human HHLA2, Fc-tagged

Cat.No. : HHLA2-548H
Product Overview : The recombinant human B7-H7-Fc fusion protein is expressed as a 574 amino acid protein consisting of Ile23 - Lys345 region of HHLA2/B7-H7 (UniProt accession #Q9UM44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Bio-activity : Inhibits anti-CD3 antibody induced cytokine (e.g., IFN- and IL-2) secretion in human T lymphocytes
Molecular Mass : Calculated molecular mass 65.0 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation
AA Sequence : MKAQTALSFFLILITSLSGSQGIFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSY YKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKY EKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWT GRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSSSQNTIINESRFSWNKELIN QSDFSMNLMDLNLSDSGEYLCNISSDEYTLLTIHTVHVEPSQETASHNKGSTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : HHLA2 HERV-H LTR-associating 2 [ Homo sapiens ]
Official Symbol : HHLA2
Synonyms : HHLA2; HERV-H LTR-associating 2; HERV-H LTR-associating protein 2; human endogenous retrovirus-H long terminal repeat-associating protein 2;
Gene ID : 11148
mRNA Refseq : NM_007072
Protein Refseq : NP_009003
MIM : 604371
UniProt ID : Q9UM44
Chromosome Location : 3q13.13
Function : molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.