Recombinant Human CD44, Fc-tagged, Biotinylated CD44-578H

Recombinant Human CD44, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD44, Fc-tagged, Biotinylated

Recombinant Human CD44, Fc-tagged, Biotinylated

CD44 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD44-578H
Product Overview : The recombinant human CD44-Fc is expressed as a 470 amino acid protein consisting of Gln21 - Thr263 region of CDw44 (UniProt accession #P16070 - isoform 12 or CDw44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized CD44-Fc protein binds hyaluronan and anti-CD44 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG with high affinity (KD< 1 nm) in a functional>
Molecular Mass : Calculated molecular mass (kDa): 52; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
AA Sequence : QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPN SICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDI YPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSES DGHSHGSQEGGANTTSGPIRTDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD44 CD44 molecule (Indian blood group) [ Homo sapiens ]
Official Symbol : CD44
Synonyms : CD44; CD44 molecule (Indian blood group); CD44 antigen (homing function and Indian blood group system) , MDU2, MDU3, MIC4; CD44 antigen; CD44R; chondroitin sulfate proteoglycan 8; CSPG8; HCELL; hematopoietic cell E and L selectin ligand; IN; MC56; Pgp1; epican; Hermes antigen; hyaluronate receptor; phagocytic glycoprotein 1; heparan sulfate proteoglycan; cell surface glycoprotein CD44; extracellular matrix receptor III; GP90 lymphocyte homing/adhesion receptor; hematopoietic cell E- and L-selectin ligand; homing function and Indian blood group system; LHR; MDU2; MDU3; MIC4; CDW44; HUTCH-I; ECMR-III; MGC10468;
Gene ID : 960
mRNA Refseq : NM_000610
Protein Refseq : NP_000601
MIM : 107269
UniProt ID : P16070
Chromosome Location : 11p13
Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem; Interferon Signaling, organism-specific biosystem;
Function : binding; collagen binding; hyaluronic acid binding; hyaluronic acid binding; hyaluronic acid binding; hyalurononglucosaminidase activity; protein binding; receptor activity; contributes_to transmembrane signaling receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy