Recombinant Human SLC3A2, Fc-tagged, Biotinylated SLC3A2-587H

Recombinant Human SLC3A2, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SLC3A2, Fc-tagged, Biotinylated

Recombinant Human SLC3A2, Fc-tagged, Biotinylated

SLC3A2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SLC3A2-587H
Product Overview : The recombinant human CD98-Fc is expressed as a 648 amino acid protein consisting of Arg110 - Ala529 region of CD98 (UniProt Accession # P08195 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized CD98 protein binds anti-CD98 monoclonal antibody human IgG1 with high affinity (KD< 10 nm) in a functional elisa. blocks cd98/lat-mediated amino acid transporter and signaling>
Molecular Mass : Calculated molecular mass (kDa): 71.8; Estimated by SDS-PAGE under reducing condition (kDa): 80-90
AA Sequence : RELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNF GSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASS FLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCS WSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSAN MTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQA SDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAASTGTHTCPPCPAPELLGGPSVFLF PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : SLC3A2 solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2 [ Homo sapiens ]
Official Symbol : SLC3A2
Synonyms : SLC3A2; solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2; MDU1; 4F2 cell-surface antigen heavy chain; 4F2; 4F2 cell surface antigen heavy chain; 4F2 heavy chain; 4F2HC; 4T2HC; antigen defined by monoclonal 4F2; antigen identified by monoclonal antibodies 4F2; TRA1.10; TROP4; and T43; CD98; CD98 heavy chain; CD98HC; heavy chain; lymphocyte activation antigen 4F2 large subunit; monoclonal 44D7; NACAE; antigen defined by monoclonal 4F2, heavy chain; antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43;
Gene ID : 6520
mRNA Refseq : NM_001012662
Protein Refseq : NP_001012680
MIM : 158070
UniProt ID : P08195
Chromosome Location : 11q12-q22
Pathway : Amino acid transport across the plasma membrane, organism-specific biosystem; Basigin interactions, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem;
Function : calcium:sodium antiporter activity; catalytic activity; cation binding; neutral amino acid transmembrane transporter activity; protein binding;

Products Types

◆ Recombinant Protein

SLC3A2-229HRecombinant Human SLC3A2 Protein, His-tagged+Inquiry
SLC3A2-949RRecombinant Rat SLC3A2 Protein (Ala100-Ala527), HlgG1 Fc-tagged+Inquiry
SLC3A2-588HRecombinant Human SLC3A2, Fc-tagged+Inquiry
SLC3A2-26956THRecombinant Human SLC3A2+Inquiry
Slc3a2-8781RRecombinant Rat Slc3a2, His tagged+Inquiry

See All SLC3A2 Recombinant Protein

◆ Lysates

SLC3A2-1199RCLRecombinant Rat SLC3A2 cell lysate+Inquiry
SLC3A2-1772MCLRecombinant Mouse SLC3A2 cell lysate+Inquiry
SLC3A2-2015HCLRecombinant Human SLC3A2 cell lysate+Inquiry

See All SLC3A2 Lysates

Related Gene

SLC25A15SLC2A1SLC4A4SLC9A3R1SLC3A2SLC11A2SLC12A1SLC15A1SLC18A1SLC19A2SLC1A2SLC20A1SLC22A13SLC22A2SLC25A11SLC25A13SLC25A4SLC25A6SLC26A2SLC26A4SLC26A5SLC27A4SLC29A4SLC2A4SLC2A4RGSLC33A1SLC36A2SLC44A1SLC44A2SLC45A2SLC4A1SLC4A8SLC5A2SLC6A4SLC9A1SLC35A3SLC2A6SLC7A8SLC30A3SLC18A2SLC2A5SLC11A1SLC12A2SLC12A4SLC13A3SLC13A5SLC14A2SLC17A4SLC19A3SLC1A3SLC20A2SLC22A12SLC22A4SLC22A6SLC25A14SLC25A16SLC25A17SLC25A20SLC25A21SLC25A5SLC26A3SLC26A9SLC27A1SLC27A2SLC27A3SLC28A2SLC2A10SLC2A2SLC30A6SLC35D2SLC39A10SLC39A13SLC3A1SLC5A3SLC6A11SLC6A16SLC6A19SLC6A20SLC6A5SLC7A1SLC7A5SLC7A7SLC9A6SLC9A8SLC1A6SLC25A18SLC25A23SLC25A24SLC25A25SLC30A5SLC46A2SLC4A1APSLC17A6SLC17A8SLC22A1SLC22A3SLC26A7SLC30A9SLC5A5SLC9A3SLC6A3SLC1A1SLC25A3SLC2A3SLC37A4SLC7A11SLC16A7SLC25A27Slc32a1SLC5A10SLC5A11SLC5A4SLC5A9Slc9a2SLC35G5SLC39A8SLC25A47SLC25A1SLC31A2SLC29A1SLC6A1SLC2A8SLC2A12SLC2A9SLC37A1SLC6A9SLC46A1SLC2A14SLC12A5SLC16A1SLC25A37SLC43A1SLC16A5SLC16A13SLC16A2SLC25A48SLC9B1SLC25A10SLC16A14SLC24A2SLC26A6SLC26A8SLC39A2SLC12A6SLC13A2SLC14A1SLC25A38SLC25A40SLC25A42SLC25A44SLC25A45SLC26A1SLC39A3SLC39A4SLC45A3SLC9A7SLC9A9SLC5A1SLC12A3SLC10A6SLC10A7SLC50A1SLC26A10SLC26A11SLC6A15SLC6A17SLC7A13SLC7A2SLC7A4SLC22A15SLC25A28SLC25A31SLC25A32SLC25A34SLC25A36SLC22A14SLC10A4SLC10A5SLC15A2SLC15A3SLC15A4SLC16A11SLC16A12SLC16A9SLC17A1SLC17A2SLC17A3SLC17A5SLC19A1SLC1A4SLC1A5SLC1A7SLC22A16SLC22A18ASSLC22A25SLC22A7SLC22A8SLC23A1SLC23A3SLC9A10SLC10A1SLC10A2SLC10A3SLC22A10SLC22A11SLC24A1SLC24A4SLC24A5SLC25A12SLC25A19SLC27A5SLC27A6SLC35A5SLC35B1SLC35B2SLC35B3SLC35B4SLC35C2SLC35D1SLC2A13SLC30A2SLC30A7SLC35A2SLC35E3SLC35E2SLC35F1SLC35F2SLC35F3SLC35F4SLC36A1SLC36A3SLC37A2SLC37A3SLC38A1SLC38A3SLC38A4SLC38A7SLC39A1SLC39A12SLC39A5SLC39A7SLC39A9SLC40A1SLC43A2SLC43A3SLC45A4SLC46A3SLC47A1SLC47A2SLC4A5SLC4A7SLC5A12SLC5A6SLC5A8SLC6A12SLC6A14SLC7A6SLC9A3R2SLC9A5SLC4A11SLC22A18SLC35E4SLC18A3SLC30A1SLC17A7SLC30A8SLC9B2SLC12A7SLC16A8SLC35D3SLC25A35SLC23A2SLC31A1SLC34A3SLC38A9SLC39A11SLC39A14SLC41A1SLC44A3SLC6A18SLC9A4SLC39A6SLC5A7SLC25A53SLC51BSLC16A10SLC16A3SLC22A17SLC22A23SLC22A9SLC24A6SLC4A2SLC4A3SLC25A26SLC25A29SLC25A30SLC25A39SLC25A41SLC28A3SLC2A7SLC30A4SLC35E1SLC36A4SLC38A10SLC38A11SLC38A2SLC38A6SLC41A2SLC6A6SLC6A7SLC7A10SLC7A6OSSLC8A2SLC9C1SLC6A13SLC7A14SLC2A11SLC29A2SLC45A1SLC8A1Slc7a9Slc12a8SLC18B1Slc6a2Slc21a4SLC13A4SLC15A5SLC22A5SLC24A3SLC25A22SLC25A2SLC25A33SLC25A51SLC28A1SLC29A3SLC34A1SLC34A2SLC35A1SLC35A4SLC35C1SLC38A5SLC38A8SLC4A10SLC44A4SLC44A5SLC48A1Slc6a20aSLC8A3Slc12a9Slc13a1Slc16a4Slc16a6Slc17a9Slc22a20Slc22a21Slc22a22Slc22a26Slc22a27Slc22a28Slc22a30Slc22a29Slc25a43Slc25a46Slc30a10Slc35e2bSlc35f5SLC35G1SLC35G2Slc35g3SLC35G6Slc39a4lSlc4a9Slc41a3Slc5a4bSlc5a4aSLC52A1Slc52a2Slc6a20bSlc6a8Slc7a12Slc7a15Slc7a3SLC9C2Slc52a3

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy