Recombinant Human CDNF, His-tagged CDNF-592H

Recombinant Human CDNF, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CDNF, His-tagged

Recombinant Human CDNF, His-tagged

CDNF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CDNF-592H
Product Overview : The recombinant human CDNF is expressed as a 174 amino acid protein consisting of Gln25 - Leu187 region of CDNF (UniProt entry Q49AH0) and a C-terminal poly-Histidine tag.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free)
Bio-activity : CDNF is reported to enhance neurite outgrowth of E18 rat embryonic cortical neurons and increases neurite outgrowth when immobilized at 6 - 24 μg/mL on a nitrocellulose- coated microplate.
Molecular Mass : Calculated molecular mass 19.9 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with a higher molecular mass band (~25 kDa) resembling a glycosylated state.
AA Sequence : QGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEV TRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQE LAPKYAATHPKTELSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CDNF cerebral dopamine neurotrophic factor [ Homo sapiens ]
Official Symbol : CDNF
Synonyms : CDNF; cerebral dopamine neurotrophic factor; arginine rich, mutated in early stage tumors like 1 , ARMETL1; conserved dopamine neurotrophic factor; ARMET-like protein 1; arginine-rich, mutated in early stage tumors-like 1; ARMETL1;
Gene ID : 441549
mRNA Refseq : NM_001029954
Protein Refseq : NP_001025125
MIM : 611233
UniProt ID : Q49AH0
Chromosome Location : 10p13
Function : growth factor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy