Recombinant Human ARMETL1 protein, GST-tagged
| Cat.No. : | ARMETL1-301309H |
| Product Overview : | Recombinant Human ARMETL1 (103-187 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met103-Leu187 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CDNF cerebral dopamine neurotrophic factor [ Homo sapiens (human) ] |
| Official Symbol | ARMETL1 |
| Synonyms | CDNF |
| Gene ID | 441549 |
| mRNA Refseq | NM_001029954 |
| Protein Refseq | NP_001025125 |
| MIM | 611233 |
| UniProt ID | Q49AH0 |
| ◆ Recombinant Proteins | ||
| CDNF-446H | Recombinant Human CDNF protein, His-tagged | +Inquiry |
| Cdnf-729M | Recombinant Mouse Cdnf Protein, His-tagged | +Inquiry |
| CDNF-592H | Active Recombinant Human CDNF, His-tagged | +Inquiry |
| CDNF-625R | Recombinant Rhesus Macaque CDNF Protein, His (Fc)-Avi-tagged | +Inquiry |
| CDNF-0997H | Recombinant Human CDNF Protein (Gly86-Leu187), N-GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDNF-2028MCL | Recombinant Mouse CDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cdnf Products
Required fields are marked with *
My Review for All Cdnf Products
Required fields are marked with *
