Recombinant Human ATF6, GST-tagged ATF6-873H

Recombinant Human ATF6, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human ATF6, GST-tagged

Recombinant Human ATF6, GST-tagged

ATF6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ATF6-873H
Product Overview : Recombinant Human ATF6 (1 a.a. - 202 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ERmolecules.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : Theoretical MW (kDa): 48.5
AA Sequence : MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWD INNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT
Applications : AP, Array, ELISA, WB-Re
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : ATF6 activating transcription factor 6 [ Homo sapiens ]
Official Symbol : ATF6
Synonyms : ATF6A; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha
Gene ID : 22926
mRNA Refseq : NM_007348
Protein Refseq : NP_031374
MIM : 605537
UniProt ID : P18850
Chromosome Location : 1q23.3
Pathway : ATF4 activates genes, organism-specific biosystem; Alzheimer's disease, conserved biosystem; Metabolism of proteins, organism-specific biosystem
Function : RNA polymerase II regulatory region sequence-specific DNA binding; cAMP response element binding; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy