"ATF6" Related Products

Expand
Expand
Expand

Recombinant Human ATF6, GST-tagged

Cat.No.: ATF6-873H
Product Overview: Recombinant Human ATF6 (1 a.a. - 202 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description: ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ERmolecules.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: Theoretical MW (kDa): 48.5
AA Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWD INNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT
Applications: AP, Array, ELISA, WB-Re
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: ATF6 activating transcription factor 6 [ Homo sapiens ]
Official Symbol: ATF6
Synonyms: ATF6A; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha
Gene ID: 22926
mRNA Refseq: NM_007348
Protein Refseq: NP_031374
MIM: 605537
UniProt ID: P18850
Chromosome Location: 1q23.3
Pathway: ATF4 activates genes, organism-specific biosystem; Alzheimer's disease, conserved biosystem; Metabolism of proteins, organism-specific biosystem
Function: RNA polymerase II regulatory region sequence-specific DNA binding; cAMP response element binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.