Recombinant Human PTPRN protein, His-tagged PTPRN-258H

Recombinant Human PTPRN protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PTPRN protein, His-tagged

Recombinant Human PTPRN protein, His-tagged

PTPRN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PTPRN-258H
Product Overview : Recombinant Human PTPRN (Arg576-Gln950) fussed with His tag at N-terminal was expressed in E. coli.
Description : Receptor-type tyrosine-protein phosphatase-like N (PTPRN) belongs to the protein-tyrosine phosphatase family and receptor class 8 subfamily. PTPRN contains 1 tyrosine-protein phosphatase domain, is expressed in neuroendocrine cells only. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. It implicated in neuroendocrine secretory processes. It may be involved in processes specific for neurosecretory granules, such as their biogenesis, trafficking or regulated exocytosis or may have a general role in neuroendocrine functions. It seems to lack intrinsic enzyme activity, may play a role in the regulation of secretory granules via its interaction with SNTB2. This PTP was found to be an autoantigen that is reactive with insulin-dependent diabetes mellitus (IDDM) patient sera, and thus may be a potential target of autoimmunity in diabetes mellitus.
Source : E. coli
Species : Human
Tag : His
Form : Supplied as a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0
AA Sequence : MGSSHHHHHHSSGLVPRGSHMRQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGP PEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEW QALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMP AYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVNLVSEH IWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRGRSCPIIVH CSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFEFALTAVAEEVNAI LKALPQ
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name : PTPRN protein tyrosine phosphatase, receptor type, N [ Homo sapiens ]
Official Symbol : PTPRN
Synonyms : IA2; IA-2; ICA512; R-PTP-N; IA-2/PTP; receptor-type tyrosine-protein phosphatase-like N; ICA 512; PTP IA-2; islet cell antigen 2; islet cell antigen 512; islet cell autoantigen 3; protein tyrosine phosphatase-like N
Gene ID : 5798
mRNA Refseq : NM_002846
Protein Refseq : NP_002837
MIM : 601773
UniProt ID : Q16849
Chromosome Location : 2q35-q36.1
Pathway : Type I diabetes mellitus, organism-specific biosystem; Type I diabetes mellitus, conserved biosystem
Function : GTPase binding; protein binding; NOT protein tyrosine phosphatase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy