Recombinant Human WASF2 protein, GST-tagged
| Cat.No. : | WASF2-1839H |
| Product Overview : | Recombinant Human WASF2 (1 a.a. - 498 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
| Availability | October 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-498 a.a. |
| Description : | This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 80.7 kDa |
| AA Sequence : | MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRL QVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFY TDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYP PTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADY PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQL RRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | WASF2 WAS protein family, member 2 [ Homo sapiens ] |
| Official Symbol | WASF2 |
| Synonyms | IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2; wiskott-Aldrich syndrome protein family member 2; WASP family Verprolin-homologous protein 2; WASP family protein member 2; WASP family protein member 4; protein WAVE-2; putative Wiskott-Aldrich syndrome protein family member 4; suppressor of cyclic-AMP receptor (WASP-family); verprolin homology domain-containing protein 2 |
| Gene ID | 10163 |
| mRNA Refseq | NM_006990 |
| Protein Refseq | NP_008921 |
| MIM | 605875 |
| UniProt ID | Q9Y6W5 |
| Chromosome Location | 1p36.11 |
| Pathway | Adherens junction, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Choline metabolism in cancer, conserved biosystem |
| Function | actin binding; protein binding; protein complex binding |
| ◆ Recombinant Proteins | ||
| WASF2-562HF | Recombinant Full Length Human WASF2 Protein, GST-tagged | +Inquiry |
| WASF2-2522HFL | Recombinant Full Length Human WASF2 protein, Flag-tagged | +Inquiry |
| WASF2-1832H | Recombinant Human WASF2 protein, GST-tagged | +Inquiry |
| Wasf2-6963M | Recombinant Mouse Wasf2 Protein, Myc/DDK-tagged | +Inquiry |
| WASF2-3357H | Recombinant Human WASF2 protein, His-GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WASF2 Products
Required fields are marked with *
My Review for All WASF2 Products
Required fields are marked with *
