Recombinant Human WASF2 protein, GST-tagged WASF2-1839H

Recombinant Human WASF2 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human WASF2 protein, GST-tagged

Recombinant Human WASF2 protein, GST-tagged

WASF2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : WASF2-1839H
Product Overview : Recombinant Human WASF2 (1 a.a. - 498 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 80.7 kDa
AA Sequence : MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRL QVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFY TDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYP PTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHP PPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADY PTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQL RRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : WASF2 WAS protein family, member 2 [ Homo sapiens ]
Official Symbol : WASF2
Synonyms : IMD2; SCAR2; WASF4; WAVE2; dJ393P12.2; wiskott-Aldrich syndrome protein family member 2; WASP family Verprolin-homologous protein 2; WASP family protein member 2; WASP family protein member 4; protein WAVE-2; putative Wiskott-Aldrich syndrome protein family member 4; suppressor of cyclic-AMP receptor (WASP-family); verprolin homology domain-containing protein 2
Gene ID : 10163
mRNA Refseq : NM_006990
Protein Refseq : NP_008921
MIM : 605875
UniProt ID : Q9Y6W5
Chromosome Location : 1p36.11
Pathway : Adherens junction, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Choline metabolism in cancer, conserved biosystem
Function : actin binding; protein binding; protein complex binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy