Recombinant Human CCND3 protein, GST-tagged

Cat.No. : CCND3-839H
Product Overview : Recombinant Human CCND3 (1 a.a. - 100 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-100 a.a.
Description : The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEE EVFPLAMNYLDRYLSCVPTRKAQLQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CCND3 cyclin D3 [ Homo sapiens ]
Official Symbol CCND3
Synonyms G1/S-specific cyclin-D3; D3-type cyclin
Gene ID 896
mRNA Refseq NM_001760
Protein Refseq NP_001751
MIM 123834
UniProt ID P30281
Chromosome Location 6p21
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell cycle - G1/S transition, organism-specific biosystem
Function cyclin-dependent protein serine/threonine kinase activity; protein binding; protein kinase binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCND3 Products

Required fields are marked with *

My Review for All CCND3 Products

Required fields are marked with *

0
cart-icon
0
compare icon