"CCND3" Related Products

Expand
Expand
Expand

Recombinant Human CCND3 protein, GST-tagged

Cat.No.: CCND3-839H
Product Overview: Recombinant Human CCND3 (1 a.a. - 100 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEE EVFPLAMNYLDRYLSCVPTRKAQLQ
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CCND3 cyclin D3 [ Homo sapiens ]
Official Symbol: CCND3
Synonyms: G1/S-specific cyclin-D3; D3-type cyclin
Gene ID: 896
mRNA Refseq: NM_001760
Protein Refseq: NP_001751
MIM: 123834
UniProt ID: P30281
Chromosome Location: 6p21
Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell cycle - G1/S transition, organism-specific biosystem
Function: cyclin-dependent protein serine/threonine kinase activity; protein binding; protein kinase binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.