Recombinant Human CCND3 protein, GST-tagged
| Cat.No. : | CCND3-839H |
| Product Overview : | Recombinant Human CCND3 (1 a.a. - 100 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-100 a.a. |
| Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activtiy is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. The CDK4 activity associated with this cyclin was reported to be necessary for cell cycle progression through G2 phase into mitosis after UV radiation. Several transcript variants encoding different isoforms have been found for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEE EVFPLAMNYLDRYLSCVPTRKAQLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | CCND3 cyclin D3 [ Homo sapiens ] |
| Official Symbol | CCND3 |
| Synonyms | G1/S-specific cyclin-D3; D3-type cyclin |
| Gene ID | 896 |
| mRNA Refseq | NM_001760 |
| Protein Refseq | NP_001751 |
| MIM | 123834 |
| UniProt ID | P30281 |
| Chromosome Location | 6p21 |
| Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell cycle - G1/S transition, organism-specific biosystem |
| Function | cyclin-dependent protein serine/threonine kinase activity; protein binding; protein kinase binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCND3 Products
Required fields are marked with *
My Review for All CCND3 Products
Required fields are marked with *



