Recombinant Human CYP11A1 protein, GST-tagged CYP11A1-7132H

Recombinant Human CYP11A1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CYP11A1 protein, GST-tagged

Recombinant Human CYP11A1 protein, GST-tagged

CYP11A1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CYP11A1-7132H
Product Overview : Recombinant Human CYP11A1(1 a.a. - 521 a.a.), fussed with GST tag at N-terminal, was expressed in Wheat Germ.
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and catalyzes the conversion of cholesterol to pregnenolone, the first and rate-limiting step in the synthesis of the steroid hormones. Two transcript variants encoding different isoforms have been found for this gene. The cellular location of the smaller isoform is unclear since it lacks the mitochondrial-targeting transit peptide.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 86.5 kDa
Protein length : 1 a.a. - 521 a.a.
AA Sequence : MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNEIPSPGDNGWLNLYHFWRETGTHKVH LHHVQNFQKYGPIYREKLGNVESVYVIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEV VNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVP LLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name : CYP11A1 cytochrome P450, family 11, subfamily A, polypeptide 1 [ Homo sapiens ]
Official Symbol : CYP11A1
Synonyms : CYP11A1; cytochrome P450, family 11, subfamily A, polypeptide 1; CYP11A, cytochrome P450, subfamily XIA (cholesterol side chain cleavage); cholesterol side-chain cleavage enzyme, mitochondrial; cholesterol monooxygenase (side chain cleaving); P450SCC; steroid 20-22-lyase; cytochrome P450 11A1; cytochrome P450(scc); cytochrome P450C11A1; cholesterol 20-22 desmolase; cholesterol monooxygenase (side-chain cleaving); cytochrome P450, subfamily XIA (cholesterol side chain cleavage); CYP11A; CYPXIA1;
Gene ID : 1583
mRNA Refseq : NM_001099773
Protein Refseq : NP_001093243
MIM : 118485
UniProt ID : P05108
Chromosome Location : 15q23-q24
Pathway : Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; Endogenous sterols, organism-specific biosystem; Glucocorticoid andamp; Mineralcorticoid Metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function : cholesterol binding; cholesterol monooxygenase (side-chain-cleaving) activity; cholesterol monooxygenase (side-chain-cleaving) activity; electron carrier activity; heme binding; metal ion binding; monooxygenase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen;

Products Types

◆ Recombinant Protein

CYP11A1-7131HRecombinant Human CYP11A1 protein, MYC/DDK-tagged+Inquiry
CYP11A1-8077HRecombinant Human CYP11A1 protein, His & T7-tagged+Inquiry
CYP11A1-8076CRecombinant Cattle CYP11A1 protein, His & T7-tagged+Inquiry
CYP11A1-11761HRecombinant Human CYP11A1, His-tagged+Inquiry
CYP11A1-1152CRecombinant Chicken CYP11A1+Inquiry

See All CYP11A1 Recombinant Protein

◆ Lysates

CYP11A1-7131HCLRecombinant Human CYP11A1 293 Cell Lysate+Inquiry

See All CYP11A1 Lysates

Related Gene

CYP2C19CYP2C9CYP2D6CYP2E1CYP3A4CYP1B1CYP24A1CYP2J2CYP46A1CYP7B1CYP1A2CYP19A1CYP26A1CYP26B1CYP2A6CYP3A5CYP3A7CYP4F11CYP4F3CYP7A1CYP2C6CYP3A23/3A1CYP1A1CYP2B6CYP4A11Cyp11a1CYP2C8CYP2D4CYP3A2CYP2C18CYP3A43CYP4B1CYP2U1CYP2W1CYP39A1CYP2D1CYP2R1CYP26C1CYP27A1CYP2S1CYP2C11CYP4V2CYP4X1CYP4Z1CYP11B1CYP19A1BCYP4F12CYP4F2CYP4F22CYP38CYP27B1CYP27C1CYP2A13CYP2A7CYP20A1CYP21A2CYP4F8CYP17A1CYP2C23CYP4A22CYP4F13Cyp2a1Cyp2a12Cyp2b3Cyp2b9Cyp2c12Cyp2c13Cyp2c22Cyp2c29Cyp2c38Cyp2c39Cyp2c40Cyp2c44Cyp2c50Cyp2c54Cyp2d11Cyp2d12Cyp2d2Cyp2d22Cyp2d26Cyp2d3Cyp2d34Cyp2d40Cyp2d5Cyp2d9Cyp2f2Cyp2f4Cyp2g1Cyp2c37Cyp21a1Cyp3a11Cyp3a13Cyp3a16Cyp3a18Cyp3a25Cyp3a41aCyp3a41bCyp3a57Cyp4a31Cyp4a32Cyp4a8Cyp4f1Cyp4f14Cyp4f15Cyp4f17Cyp4f18Cyp4f6Cyp4v3Cyp51CYP8B1Cyp11b2Cyp11b3Cyp2a2Cyp2a22Cyp2a3Cyp2a4Cyp2a5Cyp2ab1Cyp2b1Cyp2b10Cyp2b12Cyp2b13Cyp2b15Cyp2b19Cyp2b21Cyp2b23Cyp2c6v1Cyp2c65Cyp2c66Cyp2c67Cyp2c68Cyp2c69Cyp2c7CYP2F1Cyp2j10Cyp2j12Cyp2j13Cyp2j4Cyp2j8Cyp2j9Cyp2t1Cyp2t4Cyp3a23Cyp3a44Cyp3a62Cyp3a9Cyp4a1Cyp4a12aCyp4a12bCyp4a14Cyp4a2Cyp4a29Cyp4a3Cyp4a30bCyp4f39Cyp4f4Cyp4f40Cyp4f5CYP51A1Cyp3a59CYP1B1-AS1CYP2B7P1

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy