"PFKL" Related Products

Expand
Expand

Recombinant Human PFKL protein, GST-tagged

Cat.No.: PFKL-1658H
Product Overview: Recombinant Human PFKL(1 a.a. - 827 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 116.6 kDa
Protein length: 1 a.a. - 827 a.a.
AA Sequence: MCNQGRGRESSRGGLHVQGSCRGLSRSPQQETGFAKAPAGTDCFFHCSPGSRGQGDRKEEVTSEPGGTSIMSRLG GMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAY NLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGT DSALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSR GSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEAT PDTPACVVTLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLA ILNVGAPAAGMNAAVRSAVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLE SIVENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCD RIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNE KCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA PDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDK GF
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PFKL phosphofructokinase, liver [ Homo sapiens ]
Official Symbol: PFKL
Synonyms: PFKL; phosphofructokinase, liver; 6-phosphofructokinase, liver type; phosphohexokinase; phosphofructokinase 1; liver-type 1-phosphofructokinase; phosphofructo-1-kinase isozyme B; PFK-B; FLJ30173; FLJ40909; DKFZp686G1648; DKFZp686L2097;
Gene ID: 5211
mRNA Refseq: NM_001002021
Protein Refseq: NP_001002021
MIM: 171860
UniProt ID: P17858
Chromosome Location: 21q22.3
Pathway: Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; Glycolysis (Embden-Meyerhof pathway), glucose =>
Function: 6-phosphofructokinase activity; contributes_to 6-phosphofructokinase activity; ATP binding; fructose binding; fructose-6-phosphate binding; identical protein binding; kinase activity; kinase binding; metal ion binding; nucleotide binding; protein binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.