Recombinant Human PFKL protein, GST-tagged PFKL-1658H

Recombinant Human PFKL protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PFKL protein, GST-tagged

Recombinant Human PFKL protein, GST-tagged

PFKL Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PFKL-1658H
Product Overview : Recombinant Human PFKL(1 a.a. - 827 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 116.6 kDa
Protein length : 1 a.a. - 827 a.a.
AA Sequence : MCNQGRGRESSRGGLHVQGSCRGLSRSPQQETGFAKAPAGTDCFFHCSPGSRGQGDRKEEVTSEPGGTSIMSRLG GMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAY NLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGT DSALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSR GSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEAT PDTPACVVTLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLA ILNVGAPAAGMNAAVRSAVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLE SIVENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCD RIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNE KCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA PDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDK GF
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : PFKL phosphofructokinase, liver [ Homo sapiens ]
Official Symbol : PFKL
Synonyms : PFKL; phosphofructokinase, liver; 6-phosphofructokinase, liver type; phosphohexokinase; phosphofructokinase 1; liver-type 1-phosphofructokinase; phosphofructo-1-kinase isozyme B; PFK-B; FLJ30173; FLJ40909; DKFZp686G1648; DKFZp686L2097;
Gene ID : 5211
mRNA Refseq : NM_001002021
Protein Refseq : NP_001002021
MIM : 171860
UniProt ID : P17858
Chromosome Location : 21q22.3
Pathway : Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glucose metabolism, organism-specific biosystem; Glycolysis, organism-specific biosystem; Glycolysis (Embden-Meyerhof pathway), glucose =>
Function : 6-phosphofructokinase activity; contributes_to 6-phosphofructokinase activity; ATP binding; fructose binding; fructose-6-phosphate binding; identical protein binding; kinase activity; kinase binding; metal ion binding; nucleotide binding; protein binding; transferase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy