"UQCRFS1" Related Products

Expand

Recombinant Human UQCRFS1 protein, GST-tagged

Cat.No.: UQCRFS1-106H
Product Overview: Recombinant Human UQCRFS1(1 a.a. - 274 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 55.88 kDa
Protein length: 1 a.a. - 274 a.a.
AA Sequence: MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPAS VCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALA KIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPI ANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: UQCRFS1 ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [ Homo sapiens ]
Official Symbol: UQCRFS1
Synonyms: RIP1; RIS1; RISP; UQCR5; cytochrome b-c1 complex subunit Rieske, mitochondrial; Rieske iron-sulfur protein; complex III subunit 5; cytochrome b-c1 complex subunit 5; ubiquinol-cytochrome c reductase iron-sulfur subunit
Gene ID: 7386
mRNA Refseq: NM_006003
Protein Refseq: NP_005994.2
MIM: 191327
UniProt ID: P47985
Chromosome Location: 19q12
Pathway: Alzheimer's disease, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cytochrome bc1 complex, organism-specific biosystem
Function: 2 iron, 2 sulfur cluster binding; metal ion binding; protein complex binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.