Recombinant Human UQCRFS1 protein, GST-tagged UQCRFS1-106H

Recombinant Human UQCRFS1 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human UQCRFS1 protein, GST-tagged

Recombinant Human UQCRFS1 protein, GST-tagged

UQCRFS1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : UQCRFS1-106H
Product Overview : Recombinant Human UQCRFS1(1 a.a. - 274 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 55.88 kDa
Protein length : 1 a.a. - 274 a.a.
AA Sequence : MLSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAVRRPLVASVGLNVPAS VCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALA KIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPI ANAGDFGGYYCPCHGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : UQCRFS1 ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [ Homo sapiens ]
Official Symbol : UQCRFS1
Synonyms : RIP1; RIS1; RISP; UQCR5; cytochrome b-c1 complex subunit Rieske, mitochondrial; Rieske iron-sulfur protein; complex III subunit 5; cytochrome b-c1 complex subunit 5; ubiquinol-cytochrome c reductase iron-sulfur subunit
Gene ID : 7386
mRNA Refseq : NM_006003
Protein Refseq : NP_005994.2
MIM : 191327
UniProt ID : P47985
Chromosome Location : 19q12
Pathway : Alzheimer's disease, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; Cytochrome bc1 complex, organism-specific biosystem
Function : 2 iron, 2 sulfur cluster binding; metal ion binding; protein complex binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy