"TNKS" Related Products

Expand

Recombinant Human TNKS protein, GST-tagged

Cat.No.: TNKS-3328H
Product Overview: Recombinant Human TNKS(1017 a.a. - 1124 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.62 kDa
Protein length: 1017 a.a. - 1124 a.a.
AA Sequence: TERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQ GTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: TNKS tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [ Homo sapiens ]
Official Symbol: TNKS
Synonyms: TNKS; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase; tankyrase-1; PARP 5a; PARP5A; pART5; TIN1; TINF1; TNKS1; TANK1; TNKS-1; tankyrase I; poly [ADP-ribose] polymerase 5A; TRF1-interacting ankyrin-related ADP-ribose polymerase; PARPL; PARP-5a;
Gene ID: 8658
mRNA Refseq: NM_003747
Protein Refseq: NP_003738
MIM: 603303
UniProt ID: O95271
Chromosome Location: 8p23.1
Pathway: Regulation of Telomerase, organism-specific biosystem;
Function: NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.