Recombinant Human TNKS protein, GST-tagged

Cat.No. : TNKS-3328H
Product Overview : Recombinant Human TNKS(1017 a.a. - 1124 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1017 a.a. - 1124 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.62 kDa
AA Sequence : TERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQ GTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TNKS tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [ Homo sapiens ]
Official Symbol TNKS
Synonyms TNKS; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase; tankyrase-1; PARP 5a; PARP5A; pART5; TIN1; TINF1; TNKS1; TANK1; TNKS-1; tankyrase I; poly [ADP-ribose] polymerase 5A; TRF1-interacting ankyrin-related ADP-ribose polymerase; PARPL; PARP-5a;
Gene ID 8658
mRNA Refseq NM_003747
Protein Refseq NP_003738
MIM 603303
UniProt ID O95271
Chromosome Location 8p23.1
Pathway Regulation of Telomerase, organism-specific biosystem;
Function NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNKS Products

Required fields are marked with *

My Review for All TNKS Products

Required fields are marked with *

0
cart-icon