Recombinant Human TNKS protein, GST-tagged
Cat.No. : | TNKS-3328H |
Product Overview : | Recombinant Human TNKS(1017 a.a. - 1124 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1017 a.a. - 1124 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.62 kDa |
AA Sequence : | TERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQ GTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TNKS tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [ Homo sapiens ] |
Official Symbol | TNKS |
Synonyms | TNKS; tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase; tankyrase-1; PARP 5a; PARP5A; pART5; TIN1; TINF1; TNKS1; TANK1; TNKS-1; tankyrase I; poly [ADP-ribose] polymerase 5A; TRF1-interacting ankyrin-related ADP-ribose polymerase; PARPL; PARP-5a; |
Gene ID | 8658 |
mRNA Refseq | NM_003747 |
Protein Refseq | NP_003738 |
MIM | 603303 |
UniProt ID | O95271 |
Chromosome Location | 8p23.1 |
Pathway | Regulation of Telomerase, organism-specific biosystem; |
Function | NAD+ ADP-ribosyltransferase activity; metal ion binding; protein binding; transferase activity, transferring glycosyl groups; zinc ion binding; |
◆ Recombinant Proteins | ||
TNKS-459H | Recombinant Human TNKS Protein, His-tagged | +Inquiry |
TNKS-31498TH | Recombinant Human TNKS | +Inquiry |
TNKS-0837H | Recombinant Human TNKS Protein (Q1091-Q1325), Tag Free | +Inquiry |
TNKS-4878R | Recombinant Rhesus monkey TNKS Protein, His-tagged | +Inquiry |
TNKS-0836H | Recombinant Human TNKS Protein (Q1091-Q1325), His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNKS Products
Required fields are marked with *
My Review for All TNKS Products
Required fields are marked with *
0
Inquiry Basket