Recombinant Human PDCD1LG2, His-tagged, Biotinylated PDCD1LG2-660H

Recombinant Human PDCD1LG2, His-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PDCD1LG2, His-tagged, Biotinylated

Recombinant Human PDCD1LG2, His-tagged, Biotinylated

PDCD1LG2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PDCD1LG2-660H
Product Overview : The recombinant human PD-L2 ECD is expressed as a 212 amino acid protein consisting of Leu20 - Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation.
Source : Human cells
Species : Human
Tag : His
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds to its receptor PD-1 and induce the receptor-mediated signaling activity.
Molecular Mass : Calculated molecular mass 24 kDa; estimated by SDS-PAGE under reducing condition ~45 kDa (probably due to glycosylation)
AA Sequence : LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQ VRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHS RTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTSTGHHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens ]
Official Symbol : PDCD1LG2
Synonyms : PDCD1LG2; programmed cell death 1 ligand 2; B7 dendritic cell molecule; B7 DC; bA574F11.2; Btdc; CD273; PD L2; PDL2; B7-DC; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2; B7DC; PD-L2; PDCD1L2; MGC142238; MGC142240;
Gene ID : 80380
mRNA Refseq : NM_025239
Protein Refseq : NP_079515
MIM : 605723
UniProt ID : Q9BQ51
Chromosome Location : 9p24.2
Pathway : Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem;
Function : molecular_function; protein tyrosine phosphatase activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy