"PDCD1LG2" Related Products

Expand
Expand
Expand

Recombinant Human PDCD1LG2, His-tagged, Biotinylated

Cat.No.: PDCD1LG2-660H
Product Overview: The recombinant human PD-L2 ECD is expressed as a 212 amino acid protein consisting of Leu20 - Thr220 region of PD-L2 (UniProt accession #Q9BQ51) and a C-terminal His-tag. It contains 4 potential sites for N-linked glycosylation.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Binds to its receptor PD-1 and induce the receptor-mediated signaling activity.
Molecular Mass: Calculated molecular mass 24 kDa; estimated by SDS-PAGE under reducing condition ~45 kDa (probably due to glycosylation)
AA Sequence: LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQ VRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHS RTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTSTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >90% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: PDCD1LG2 programmed cell death 1 ligand 2 [ Homo sapiens ]
Official Symbol: PDCD1LG2
Synonyms: PDCD1LG2; programmed cell death 1 ligand 2; B7 dendritic cell molecule; B7 DC; bA574F11.2; Btdc; CD273; PD L2; PDL2; B7-DC; PD-1 ligand 2; PD-1-ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; programmed death ligand 2; B7DC; PD-L2; PDCD1L2; MGC142238; MGC142240;
Gene ID: 80380
mRNA Refseq: NM_025239
Protein Refseq: NP_079515
MIM: 605723
UniProt ID: Q9BQ51
Chromosome Location: 9p24.2
Pathway: Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; PD-1 signaling, organism-specific biosystem;
Function: molecular_function; protein tyrosine phosphatase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.