Recombinant Human RSPO1, Fc-tagged, Biotinylated RSPO1-670H

Recombinant Human RSPO1, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human RSPO1, Fc-tagged, Biotinylated

Recombinant Human RSPO1, Fc-tagged, Biotinylated

RSPO1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : RSPO1-670H
Product Overview : The recombinant human RPSO1-Fc fusion is expressed as a 481 amino acid protein consisting of Ser21 - Ala263 region of (UniProt accession #Q2MKA7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 50 - 200 ng/ml.
Molecular Mass : Calculated molecular mass (kDa): 53.5; Estimated by SDS-PAGE under reducing condition (kDa): 55-60.
AA Sequence : SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFR RGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRK GQQQQQQQGTVGPLTSAGPASTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : RSPO1 R-spondin 1 [ Homo sapiens ]
Official Symbol : RSPO1
Synonyms : RSPO1; R-spondin 1; R spondin homolog (Xenopus laevis); R-spondin-1; FLJ40906; RSPONDIN; R-spondin homolog; roof plate-specific spondin-1; RSPO; CRISTIN3; RP11-566C13.1;
Gene ID : 284654
mRNA Refseq : NM_001038633
Protein Refseq : NP_001033722
MIM : 609595
UniProt ID : Q2MKA7
Chromosome Location : 1p34.2
Pathway : Wnt signaling network, organism-specific biosystem;
Function : heparin binding; protein binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy