"SIGIRR" Related Products

Expand
Expand
Expand

Recombinant Human SIGIRR, Fc-tagged, Biotinylated

Cat.No.: SIGIRR-674H
Product Overview: The recombinant human SIGIRR ECD is expressed as a 357 amino acid protein consisting of Met1 -His118 region of SIGIRR (UniProt accession #Q6IA17) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Molecular Mass: Calculated molecular mass (kDa): 39.3; Estimated by SDS-PAGE under reducing condition (kDa): ~55 (probably due to glycosylation).
AA Sequence: MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANL SEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHGSTTENLYFQGSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ]
Official Symbol: SIGIRR
Synonyms: SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; toll/interleukin-1 receptor 8; single Ig IL-1R-related molecule; single immunoglobulin domain-containing IL1R-related protein; MGC110992;
Gene ID: 59307
mRNA Refseq: NM_001135053
Protein Refseq: NP_001128525
MIM: 605478
UniProt ID: Q6IA17
Chromosome Location: 11p15.5
Pathway: Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem; Toll Like Receptor 4 (TLR4) Cascade, organism-specific biosystem; Toll Like Receptor TLR1:TLR2 Cascade, organism-specific biosystem;
Function: protein binding; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.