Recombinant Human SIGIRR, Fc-tagged, Biotinylated

• Cat.No.: SIGIRR-674H
• Product Overview: The recombinant human SIGIRR ECD is expressed as a 357 amino acid protein consisting of Met1 -His118 region of SIGIRR (UniProt accession #Q6IA17) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 1-118 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Molecular Mass: Calculated molecular mass (kDa): 39.3; Estimated by SDS-PAGE under reducing condition (kDa): ~55 (probably due to glycosylation).
• AA Sequence: MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANL SEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSHGSTTENLYFQGSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ]
• Official Symbol: SIGIRR
• Synonyms: SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; toll/interleukin-1 receptor 8; single Ig IL-1R-related molecule; single immunoglobulin domain-containing IL1R-related protein; MGC110992
• Gene ID: 59307
• mRNA Refseq: NM_001135053
• Protein Refseq: NP_001128525
• MIM: 605478
• UniProt ID: Q6IA17
• Chromosome Location: 11p15.5
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem; Toll Like Receptor 4 (TLR4) Cascade, organism-specific biosystem; Toll Like Receptor TLR1:TLR2 Cascade, organism-specific biosystem
• Function: protein binding; transmembrane signaling receptor activity