Recombinant Human SIGIRR, His-tagged
Cat.No. : | SIGIRR-28785TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 203-410 of Human SIGIRR with N terminal His tag; 208 amino acids, 32kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 203-410 a.a. |
Description : | Single Ig IL-1-related receptor is a protein that in humans is encoded by the SIGIRR gene. |
Conjugation : | HIS |
Tissue specificity : | Mainly expressed in epithelial tissues such as kidney, lung and gut. |
Form : | Lyophilised:Reconstitute with 121 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSF REGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDP QTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGV RGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYS ARTDFYCLVSKDDM |
Sequence Similarities : | Belongs to the interleukin-1 receptor family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 TIR domain. |
Gene Name | SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ] |
Official Symbol | SIGIRR |
Synonyms | SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8; |
Gene ID | 59307 |
mRNA Refseq | NM_001135053 |
Protein Refseq | NP_001128525 |
MIM | 605478 |
Uniprot ID | Q6IA17 |
Chromosome Location | 11p15.5 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem; |
Function | protein binding; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
SIGIRR-5400R | Recombinant Rat SIGIRR Protein | +Inquiry |
Sigirr-1952R | Recombinant Rat Sigirr protein, His-tagged | +Inquiry |
SIGIRR-674H | Recombinant Human SIGIRR, Fc-tagged, Biotinylated | +Inquiry |
Sigirr-10614M | Recombinant Mouse Sigirr Protein, His (Fc)-Avi-tagged | +Inquiry |
SIGIRR-2708H | Recombinant Human SIGIRR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGIRR-2773MCL | Recombinant Mouse SIGIRR cell lysate | +Inquiry |
SIGIRR-1091HCL | Recombinant Human SIGIRR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGIRR Products
Required fields are marked with *
My Review for All SIGIRR Products
Required fields are marked with *