Recombinant Human SIGIRR, His-tagged

Cat.No. : SIGIRR-28785TH
Product Overview : Recombinant fragment, corresponding to amino acids 203-410 of Human SIGIRR with N terminal His tag; 208 amino acids, 32kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 203-410 a.a.
Description : Single Ig IL-1-related receptor is a protein that in humans is encoded by the SIGIRR gene.
Conjugation : HIS
Tissue specificity : Mainly expressed in epithelial tissues such as kidney, lung and gut.
Form : Lyophilised:Reconstitute with 121 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSF REGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDP QTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGV RGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYS ARTDFYCLVSKDDM
Sequence Similarities : Belongs to the interleukin-1 receptor family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 TIR domain.
Gene Name SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ]
Official Symbol SIGIRR
Synonyms SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8;
Gene ID 59307
mRNA Refseq NM_001135053
Protein Refseq NP_001128525
MIM 605478
Uniprot ID Q6IA17
Chromosome Location 11p15.5
Pathway Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem;
Function protein binding; transmembrane signaling receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIGIRR Products

Required fields are marked with *

My Review for All SIGIRR Products

Required fields are marked with *

0
cart-icon