Recombinant Human SIGIRR, His-tagged

• Cat.No.: SIGIRR-28785TH
• Product Overview: Recombinant fragment, corresponding to amino acids 203-410 of Human SIGIRR with N terminal His tag; 208 amino acids, 32kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 203-410 a.a.
• Description: Single Ig IL-1-related receptor is a protein that in humans is encoded by the SIGIRR gene.
• Conjugation: HIS
• Tissue specificity: Mainly expressed in epithelial tissues such as kidney, lung and gut.
• Form: Lyophilised:Reconstitute with 121 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSF REGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDP QTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGV RGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYS ARTDFYCLVSKDDM
• Sequence Similarities: Belongs to the interleukin-1 receptor family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 TIR domain.

Gene Information

• Gene Name: SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ]
• Official Symbol: SIGIRR
• Synonyms: SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8
• Gene ID: 59307
• mRNA Refseq: NM_001135053
• Protein Refseq: NP_001128525
• MIM: 605478
• Uniprot ID: Q6IA17
• Chromosome Location: 11p15.5
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem
• Function: protein binding; transmembrane signaling receptor activity