Active Recombinant Human LY9, Fc-tagged, Biotinylated

• Cat.No.: LY9-681H
• Product Overview: The recombinant human SLAMF3-Fc fusion protein is expressed as a 540-amino acid protein consisting of Lys48 - Arg359 region of SLAMF3 (UniProt accession #Q9HBG7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 48-359 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized SLAMF3 binds homophilically to biotinylated SLAMF3 in a functional ELISA
• Molecular Mass: Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
• AA Sequence: KDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNL TLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPRE PHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPL ALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEA SSVTSMTHVTLLIYRRSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: LY9 lymphocyte antigen 9 [ Homo sapiens ]
• Official Symbol: LY9
• Synonyms: LY9; lymphocyte antigen 9; T-lymphocyte surface antigen Ly-9; CD229; hly9; mLY9; SLAMF3; cell surface molecule Ly-9; cell-surface molecule Ly-9
• Gene ID: 4063
• mRNA Refseq: NM_001033667
• Protein Refseq: NP_001028839
• MIM: 600684
• UniProt ID: Q9HBG7
• Chromosome Location: 1q23.3
• Function: molecular_function; receptor activity