Recombinant Human LY9, Fc-tagged LY9-682H

Recombinant Human LY9, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LY9, Fc-tagged

Recombinant Human LY9, Fc-tagged

LY9 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LY9-682H
Product Overview : The recombinant human SLAMF3-Fc fusion protein is expressed as a 540-amino acid protein consisting of Lys48 - Arg359 region of SLAMF3 (UniProt accession #Q9HBG7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Immobilized SLAMF3 binds homophilically to biotinylated SLAMF3 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 75-85
AA Sequence : KDSAPTVVSGILGGSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNL TLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPRE PHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPL ALPACRDTEKVVWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEA SSVTSMTHVTLLIYRRSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : LY9 lymphocyte antigen 9 [ Homo sapiens ]
Official Symbol : LY9
Synonyms : LY9; lymphocyte antigen 9; T-lymphocyte surface antigen Ly-9; CD229; hly9; mLY9; SLAMF3; cell surface molecule Ly-9; cell-surface molecule Ly-9;
Gene ID : 4063
mRNA Refseq : NM_001033667
Protein Refseq : NP_001028839
MIM : 600684
UniProt ID : Q9HBG7
Chromosome Location : 1q23.3
Function : molecular_function; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy