Recombinant Human CD244, Fc-tagged, Biotinylated CD244-684H

Recombinant Human CD244, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD244, Fc-tagged, Biotinylated

Recombinant Human CD244, Fc-tagged, Biotinylated

CD244 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD244-684H
Product Overview : he recombinant human SLAMF4 ECD protein is expressed as a 431-amino acid protein consisting of Cys22 - Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 - isoform 2) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence : CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ]
Official Symbol : CD244
Synonyms : CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL;
Gene ID : 51744
mRNA Refseq : NM_001166663
Protein Refseq : NP_001160135
MIM : 605554
UniProt ID : Q9BZW8
Chromosome Location : 1q23.1
Pathway : Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function : protein binding; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy