Recombinant Human SLAMF6, Fc-tagged, Biotinylated SLAMF6-687H

Recombinant Human SLAMF6, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SLAMF6, Fc-tagged, Biotinylated

Recombinant Human SLAMF6, Fc-tagged, Biotinylated

SLAMF6 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SLAMF6-687H
Product Overview : The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 - Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized SLAMF6 interacts homophilically with SLAMF6 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 48.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence : QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQ LSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEAL GNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKSTGTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : SLAMF6 SLAM family member 6 [ Homo sapiens ]
Official Symbol : SLAMF6
Synonyms : SLAMF6; SLAM family member 6; CD352; KALI; KALIb; Ly108; NTB A; NTBA; SF2000; NTBA receptor; NK-T-B-antigen; activating NK receptor; natural killer-, T- and B-cell antigen; NTB-A; FLJ50657; MGC104953;
Gene ID : 114836
mRNA Refseq : NM_001184714
Protein Refseq : NP_001171643
MIM : 606446
UniProt ID : Q96DU3
Chromosome Location : 1q23.1
Function : receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy