"SLAMF8" Related Products

Expand
Expand

Recombinant Human SLAMF8, Fc-tagged

Cat.No.: SLAMF8-690H
Product Overview: The recombinant human SLAMF8-Fc fusion protein is expressed as a 440-amino acid protein consisting of Ala23 - Val234 region of SLAMF8 (UniProt accession #Q9P0V8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity: Immobilized SLAMF8 interacts homophilically with SLAMF8 in a functional ELISA
Molecular Mass: Calculated molecular mass (kDa): 49.1; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence: AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESG DSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTM DFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVSTGTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: SLAMF8 SLAM family member 8 [ Homo sapiens ]
Official Symbol: SLAMF8
Synonyms: SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578;
Gene ID: 56833
mRNA Refseq: NM_020125
Protein Refseq: NP_064510
MIM: 606620
UniProt ID: Q9P0V8
Chromosome Location: 1q23.1
Function: receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.