Recombinant Human TIE1, Fc-tagged TIE1-701H

Recombinant Human TIE1, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TIE1, Fc-tagged

Recombinant Human TIE1, Fc-tagged

TIE1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TIE1-701H
Product Overview : The recombinant human Tie1-Fc fusion is expressed as a 967 amino acid protein consisting of Ala22 - Gln759 region of Tie1 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Interacts with Tie2 and inhibits angiopoietin/Tie2-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 105.5; Estimated by SDS-PAGE under reducing condition (kDa): 110-120
AA Sequence : AVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSK PSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLD WHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGE CVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRL QCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKP DGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLV VSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLM TTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTP GTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGG AGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQ GSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : TIE1 tyrosine kinase with immunoglobulin-like and EGF-like domains 1 [ Homo sapiens ]
Official Symbol : TIE1
Synonyms : TIE1; tyrosine kinase with immunoglobulin-like and EGF-like domains 1; TIE, tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; tyrosine-protein kinase receptor Tie-1; JTK14; tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; TIE;
Gene ID : 7075
mRNA Refseq : NM_001253357
Protein Refseq : NP_001240286
MIM : 600222
UniProt ID : P35590
Chromosome Location : 1p34-p33
Function : ATP binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy