Active Recombinant Mouse Lif, Fc-tagged, Biotinylated
| Cat.No. : | Lif-720M |
| Product Overview : | The recombinant mouse LIF-Fc fusion protein is expressed as a 419-amino acid protein consisting of Ser24 - Phe203 region of (UniProt accession #P09056) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 24-203 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.4 - 1 ng/ml. Induce IL-6 secretion in M1 mouse myeloid leukemia cells. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency. |
| Molecular Mass : | Calculated molecular mass (kDa): 46.6; Estimated by SDS-PAGE under reducing condition (kDa): 60-65 |
| AA Sequence : | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGT EKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | Lif leukemia inhibitory factor [ Mus musculus ] |
| Official Symbol | Lif |
| Synonyms | LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor; |
| Gene ID | 16878 |
| mRNA Refseq | NM_001039537 |
| Protein Refseq | NP_001034626 |
| MIM | |
| UniProt ID | |
| Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; ESC Pluripotency Pathways, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
| Function | cytokine activity; cytokine activity; growth factor activity; growth factor activity; leukemia inhibitory factor receptor binding; receptor binding; |
| ◆ Recombinant Proteins | ||
| LIF-2202R | Recombinant Rat LIF protein, His-tagged | +Inquiry |
| LIF-514H | Active Recombinant Human LIF | +Inquiry |
| LIF-02H | Recombinant Human LIF Protein, His-tagged | +Inquiry |
| LIF-162H | Recombinant Human LIF Protein, 23AA-202AA, Tag Free, Biotinylated | +Inquiry |
| LIF-301508H | Recombinant Human LIF protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
| LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lif Products
Required fields are marked with *
My Review for All Lif Products
Required fields are marked with *
