Recombinant Mouse Lif, Fc-tagged, Biotinylated Lif-720M

Recombinant Mouse Lif, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Lif, Fc-tagged, Biotinylated

Recombinant Mouse Lif, Fc-tagged, Biotinylated

Lif Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Lif-720M
Product Overview : The recombinant mouse LIF-Fc fusion protein is expressed as a 419-amino acid protein consisting of Ser24 - Phe203 region of (UniProt accession #P09056) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Mouse
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.4 - 1 ng/ml. Induce IL-6 secretion in M1 mouse myeloid leukemia cells. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Molecular Mass : Calculated molecular mass (kDa): 46.6; Estimated by SDS-PAGE under reducing condition (kDa): 60-65
AA Sequence : SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGT EKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : Lif leukemia inhibitory factor [ Mus musculus ]
Official Symbol : Lif
Synonyms : LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor;
Gene ID : 16878
mRNA Refseq : NM_001039537
Protein Refseq : NP_001034626
MIM :
UniProt ID :
Pathway : Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; ESC Pluripotency Pathways, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function : cytokine activity; cytokine activity; growth factor activity; growth factor activity; leukemia inhibitory factor receptor binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy