"Lif" Related Products

Expand
Expand

Recombinant Mouse Lif, Fc-tagged, Biotinylated

Cat.No.: Lif-720M
Product Overview: The recombinant mouse LIF-Fc fusion protein is expressed as a 419-amino acid protein consisting of Ser24 - Phe203 region of (UniProt accession #P09056) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Mouse
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.4 - 1 ng/ml. Induce IL-6 secretion in M1 mouse myeloid leukemia cells. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Molecular Mass: Calculated molecular mass (kDa): 46.6; Estimated by SDS-PAGE under reducing condition (kDa): 60-65
AA Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGT EKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPD HSDKEAFQRKKLGCQLLGTYKQVISVVVQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >90% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: Lif leukemia inhibitory factor [ Mus musculus ]
Official Symbol: Lif
Synonyms: LIF; leukemia inhibitory factor; d factor; differentiation-stimulating factor;
Gene ID: 16878
mRNA Refseq: NM_001039537
Protein Refseq: NP_001034626
MIM:
UniProt ID:
Pathway: Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; ESC Pluripotency Pathways, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem;
Function: cytokine activity; cytokine activity; growth factor activity; growth factor activity; leukemia inhibitory factor receptor binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.