Recombinant Human TSPAN7 protein
| Cat.No. : | TSPAN7-237H |
| Product Overview : | Recombinant Human TSPAN7 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. |
| Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Molecular Mass : | 27.6 kDa |
| AA Sequence : | MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLF GCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSC CGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAF SQLIGMLLACCLSRFITANQYEMV |
| Purity : | > 95 % by SDS-PAGE. |
| Applications : | Antibody Production; Functional Study(Recommended usage only, not validated yet); Compound Screening(Recommended usage only, not validated yet). |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | TSPAN7 tetraspanin 7 [ Homo sapiens ] |
| Official Symbol | TSPAN7 |
| Synonyms | TSPAN7; tetraspanin 7; mental retardation, X linked 58 , MRX58, MXS1, TM4SF2, transmembrane 4 superfamily member 2; tetraspanin-7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; tetraspanin protein; transmembrane protein A15; cell surface glycoprotein A15; transmembrane 4 superfamily 2b; transmembrane 4 superfamily member 2; membrane component chromosome X surface marker 1; membrane component, X chromosome, surface marker 1; T-cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b; |
| Gene ID | 7102 |
| mRNA Refseq | NM_004615 |
| Protein Refseq | NP_004606 |
| MIM | 300096 |
| UniProt ID | P41732 |
| Chromosome Location | Xp11.4 |
| Pathway | Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
| ◆ Recombinant Proteins | ||
| TSPAN7-237H | Recombinant Human TSPAN7 protein | +Inquiry |
| TSPAN7-0269C | Recombinant Cynomolgus TSPAN7 protein, mFc-tagged | +Inquiry |
| Tspan7-196R | Recombinant Rat Tspan7 protein, His-tagged | +Inquiry |
| TSPAN7-571HF | Recombinant Full Length Human TSPAN7 Protein | +Inquiry |
| TSPAN7-5004R | Recombinant Rhesus monkey TSPAN7 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TSPAN7-813CCL | Recombinant Cynomolgus TSPAN7 cell lysate | +Inquiry |
| TSPAN7-861MCL | Recombinant Mouse TSPAN7 cell lysate | +Inquiry |
| TSPAN7-863HCL | Recombinant Human TSPAN7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN7 Products
Required fields are marked with *
My Review for All TSPAN7 Products
Required fields are marked with *
