Recombinant Human TSPAN7 protein TSPAN7-237H

Recombinant Human TSPAN7 protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human TSPAN7 protein

Recombinant Human TSPAN7 protein

TSPAN7 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : TSPAN7-237H
Product Overview : Recombinant Human TSPAN7 was expressed in Wheat Germ.
Description : The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.
Source : Wheat Germ
Species : Human
Form : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass : 27.6 kDa
AA Sequence : MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLF GCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSC CGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAF SQLIGMLLACCLSRFITANQYEMV
Purity : > 95 % by SDS-PAGE.
Applications : Antibody Production; Functional Study(Recommended usage only, not validated yet); Compound Screening(Recommended usage only, not validated yet).
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : TSPAN7 tetraspanin 7 [ Homo sapiens ]
Official Symbol : TSPAN7
Synonyms : TSPAN7; tetraspanin 7; mental retardation, X linked 58 , MRX58, MXS1, TM4SF2, transmembrane 4 superfamily member 2; tetraspanin-7; A15; CD231; DXS1692E; TALLA 1; tspan-7; CD231 antigen; tetraspanin protein; transmembrane protein A15; cell surface glycoprotein A15; transmembrane 4 superfamily 2b; transmembrane 4 superfamily member 2; membrane component chromosome X surface marker 1; membrane component, X chromosome, surface marker 1; T-cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; MXS1; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b;
Gene ID : 7102
mRNA Refseq : NM_004615
Protein Refseq : NP_004606
MIM : 300096
UniProt ID : P41732
Chromosome Location : Xp11.4
Pathway : Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy