Recombinant Human UCP1 protein, GST-tagged
Cat.No. : | UCP1-46H |
Product Overview : | Recombinant Human UCP1(232 a.a. - 267 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
Description : | Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 29.7 kDa |
AA Sequence : | PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name : | UCP1 uncoupling protein 1 (mitochondrial, proton carrier) [ Homo sapiens ] |
Official Symbol : | UCP1 |
Synonyms : | UCP1; uncoupling protein 1 (mitochondrial, proton carrier); UCP; mitochondrial brown fat uncoupling protein 1; SLC25A7; thermogenin; solute carrier family 25 member 7; |
Gene ID : | 7350 |
mRNA Refseq : | NM_021833 |
Protein Refseq : | NP_068605 |
MIM : | 113730 |
UniProt ID : | P25874 |
Chromosome Location : | 4q28-q31 |
Pathway : | Adipogenesis, organism-specific biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Metabolism, organism-specific biosystem; Mitochondrial Uncoupling Proteins, organism-specific biosystem; PPAR signaling pathway, organism-specific biosystem; |
Function : | anion transmembrane transporter activity; oxidative phosphorylation uncoupler activity; |
Products Types
◆ Recombinant Protein | ||
UCP1-846H | Recombinant Human UCP1 Protein (2-307 aa), His-SUMO-tagged | +Inquiry |
Ucp1-283R | Recombinant Rat Ucp1 Protein, His/GST-tagged | +Inquiry |
Ucp1-281M | Recombinant Mouse Ucp1 Protein, His-tagged | +Inquiry |
UCP1-9872M | Recombinant Mouse UCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCP1-6077R | Recombinant Rat UCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
UCP1-526HCL | Recombinant Human UCP1 293 Cell Lysate, Flag-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionCustomer Reviews (3)
Write a reviewStandardized usage protocols of protein reagents facilitate data sharing and comparison with other laboratories.
The application process of protein reagents is convenient, requiring minimal complex sample handling steps.
Protein reagents possess high purity, guaranteeing reliable results without interference from impurities.
Ask a Question for All UCP1 Products
Required fields are marked with *
My Review for All UCP1 Products
Required fields are marked with *
Inquiry Basket