Recombinant Full Length Human Mitochondrial Brown Fat Uncoupling Protein 1(Ucp1) Protein, His-Tagged
| Cat.No. : | RFL19243HF |
| Product Overview : | Recombinant Full Length Human Mitochondrial brown fat uncoupling protein 1(UCP1) Protein (P25874) (1-307aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-307) |
| Form : | Lyophilized powder |
| AA Sequence : | MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR QTMDCAT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | UCP1 |
| Synonyms | mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP 1; UCP; UCP1; UCP1_HUMAN; uncoupling protein 1 (mitochondrial, proton carrier); Uncoupling protein 1 |
| UniProt ID | P25874 |
| ◆ Recombinant Proteins | ||
| UCP1-6077R | Recombinant Rat UCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL9919RF | Recombinant Full Length Rat Mitochondrial Brown Fat Uncoupling Protein 1(Ucp1) Protein, His-Tagged | +Inquiry |
| UCP1-9872M | Recombinant Mouse UCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UCP1-9931Z | Recombinant Zebrafish UCP1 | +Inquiry |
| UCP1-1552H | Recombinant Human UCP1 Protein (2-307 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UCP1-526HCL | Recombinant Human UCP1 293 Cell Lysate, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCP1 Products
Required fields are marked with *
My Review for All UCP1 Products
Required fields are marked with *



