"CDR2L" Related Products

Expand

Recombinant Human CDR2L protein, GST-tagged

Cat.No.: CDR2L-129H
Product Overview: Recombinant Human CDR2L(1 a.a. - 459 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 50.5 kDa
Protein length: 1 a.a. - 459 a.a.
AA Sequence: MEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHA KVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIH TFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELE RQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPA ASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGV RHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINA TKVKTHSSK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: CDR2L cerebellar degeneration-related protein 2-like [ Homo sapiens ]
Official Symbol: CDR2L
Synonyms: cdr2l; CDR2L_HUMAN; Cerebellar degeneration-related protein 2-like; Gm21; Paraneoplastic 62 kDa antigen; paraneoplastic antigen; HUMPPA
Gene ID: 30850
mRNA Refseq: NM_014603.2
Protein Refseq: NP_055418.2
MIM:
UniProt ID: Q86X02
Chromosome Location: 17q25.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.