Recombinant Human CDR2L protein, GST-tagged CDR2L-129H

Recombinant Human CDR2L protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CDR2L protein, GST-tagged

Recombinant Human CDR2L protein, GST-tagged

CDR2L Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CDR2L-129H
Product Overview : Recombinant Human CDR2L(1 a.a. - 459 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 50.5 kDa
Protein length : 1 a.a. - 459 a.a.
AA Sequence : MEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQLDTLRHVNEQHA KVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIH TFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELE RQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPA ASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGV RHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINA TKVKTHSSK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : CDR2L cerebellar degeneration-related protein 2-like [ Homo sapiens ]
Official Symbol : CDR2L
Synonyms : cdr2l; CDR2L_HUMAN; Cerebellar degeneration-related protein 2-like; Gm21; Paraneoplastic 62 kDa antigen; paraneoplastic antigen; HUMPPA
Gene ID : 30850
mRNA Refseq : NM_014603.2
Protein Refseq : NP_055418.2
UniProt ID : Q86X02
Chromosome Location : 17q25.1

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy