Recombinant Human GNAL protein, GST-tagged

• Cat.No.: GNAL-46H
• Product Overview: Recombinant Human GNAL(359 a.a. - 458 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 359-458 a.a.
• Description: This gene encodes a stimulatory G protein alpha subunit which mediates odorant signaling in the olfactory epithelium. This protein couples dopamine type 1 receptors and adenosine A2A receptors and is widely expressed in the central nervous system. Mutations in this gene have been associated with dystonia 25 and this gene is located in a susceptibility region for bipolar disorder and schizophrenia. Alternative splicing results in multiple transcript variants.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: DMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDT ENIRRVFNDCRDIIQRMHLKQYELL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [ Homo sapiens ]
• Official Symbol: GNAL
• Synonyms: GNAL; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type; guanine nucleotide-binding protein G(olf) subunit alpha; adenylate cyclase-stimulating G alpha protein, olfactory type; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory typ; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide, olfactory type
• Gene ID: 2774
• mRNA Refseq: NM_182978
• Protein Refseq: NP_892023
• MIM: 139312
• UniProt ID: P38405
• Chromosome Location: 18p11.22-p11.21
• Pathway: Activation of GABAB receptors, organism-specific biosystem; Adenylate cyclase activating pathway, organism-specific biosystem; Adenylate cyclase inhibitory pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem
• Function: G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding; GTPase activity; adenylate cyclase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; signal transducer activity; signal transducer activity