Recombinant Human GNAL protein, GST-tagged

Cat.No. : GNAL-46H
Product Overview : Recombinant Human GNAL(359 a.a. - 458 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 359-458 a.a.
Description : This gene encodes a stimulatory G protein alpha subunit which mediates odorant signaling in the olfactory epithelium. This protein couples dopamine type 1 receptors and adenosine A2A receptors and is widely expressed in the central nervous system. Mutations in this gene have been associated with dystonia 25 and this gene is located in a susceptibility region for bipolar disorder and schizophrenia. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : DMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDT ENIRRVFNDCRDIIQRMHLKQYELL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [ Homo sapiens ]
Official Symbol GNAL
Synonyms GNAL; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type; guanine nucleotide-binding protein G(olf) subunit alpha; adenylate cyclase-stimulating G alpha protein, olfactory type; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory typ; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide, olfactory type;
Gene ID 2774
mRNA Refseq NM_182978
Protein Refseq NP_892023
MIM 139312
UniProt ID P38405
Chromosome Location 18p11.22-p11.21
Pathway Activation of GABAB receptors, organism-specific biosystem; Adenylate cyclase activating pathway, organism-specific biosystem; Adenylate cyclase inhibitory pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem;
Function G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding; GTPase activity; adenylate cyclase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; signal transducer activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNAL Products

Required fields are marked with *

My Review for All GNAL Products

Required fields are marked with *

0
cart-icon
0
compare icon