Recombinant Human GNAL protein, GST-tagged
Cat.No. : | GNAL-45H |
Product Overview : | Recombinant Human GNAL(1 a.a. - 458 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-458 a.a. |
Description : | This gene encodes a stimulatory G protein alpha subunit which mediates odorant signaling in the olfactory epithelium. This protein couples dopamine type 1 receptors and adenosine A2A receptors and is widely expressed in the central nervous system. Mutations in this gene have been associated with dystonia 25 and this gene is located in a susceptibility region for bipolar disorder and schizophrenia. Alternative splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 78.9 kDa |
AA Sequence : | MGLCYSLRPLLFGGPGDDPCAASEPPVEDAQPAPAPALAPVRAAARDTARTLLPRGGEGSPACARPKADKPKEKR QRTEQLSAEEREAAKEREAVKEARKVSRGIDRMLRDQKRDLQQTHRLLLLGAGESGKSTIVKQMRILHVNGFNPE EKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKA CFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQ CFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDY FPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRM HLKQYELL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | GNAL guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [ Homo sapiens ] |
Official Symbol | GNAL |
Synonyms | GNAL; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type; guanine nucleotide-binding protein G(olf) subunit alpha; adenylate cyclase-stimulating G alpha protein, olfactory type; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory typ; guanine nucleotide binding protein (G protein), alpha stimulating activity polypeptide, olfactory type; |
Gene ID | 2774 |
mRNA Refseq | NM_182978 |
Protein Refseq | NP_892023 |
MIM | 139312 |
UniProt ID | P38405 |
Chromosome Location | 18p11.22-p11.21 |
Pathway | Activation of GABAB receptors, organism-specific biosystem; Adenylate cyclase activating pathway, organism-specific biosystem; Adenylate cyclase inhibitory pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; |
Function | G-protein beta/gamma-subunit complex binding; G-protein coupled receptor binding; GTP binding; GTPase activity; adenylate cyclase activity; guanyl nucleotide binding; metal ion binding; nucleotide binding; signal transducer activity; signal transducer activity; |
◆ Recombinant Proteins | ||
GNAL-1870C | Recombinant Chicken GNAL | +Inquiry |
GNAL-1728Z | Recombinant Zebrafish GNAL | +Inquiry |
GNAL-46H | Recombinant Human GNAL protein, GST-tagged | +Inquiry |
GNAL-3759M | Recombinant Mouse GNAL Protein, His (Fc)-Avi-tagged | +Inquiry |
GNAL-45H | Recombinant Human GNAL protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNAL Products
Required fields are marked with *
My Review for All GNAL Products
Required fields are marked with *
0
Inquiry Basket