Recombinant Human IMMT protein, GST-tagged IMMT-839H

Recombinant Human IMMT protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IMMT protein, GST-tagged

Recombinant Human IMMT protein, GST-tagged

IMMT Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IMMT-839H
Product Overview : Recombinant Human IMMT(481 a.a. - 580 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : Mitochondrial inner membrane protein is a protein that in humans is encoded by the IMMT gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQS HAVAEEEARKAHQLWLSVEALKYSM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : IMMT inner membrane protein, mitochondrial [ Homo sapiens ]
Official Symbol : IMMT
Synonyms : IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653;
Gene ID : 10989
mRNA Refseq : NM_006839
Protein Refseq : NP_006830
MIM : 600378
UniProt ID : Q16891
Chromosome Location : 2p11.2
Function : protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy