"IMMT" Related Products

Expand
Expand

Recombinant Human IMMT protein, GST-tagged

Cat.No.: IMMT-839H
Product Overview: Recombinant Human IMMT(481 a.a. - 580 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Mitochondrial inner membrane protein is a protein that in humans is encoded by the IMMT gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQS HAVAEEEARKAHQLWLSVEALKYSM
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: IMMT inner membrane protein, mitochondrial [ Homo sapiens ]
Official Symbol: IMMT
Synonyms: IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653;
Gene ID: 10989
mRNA Refseq: NM_006839
Protein Refseq: NP_006830
MIM: 600378
UniProt ID: Q16891
Chromosome Location: 2p11.2
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.