Recombinant Human IMMT protein, GST-tagged

Cat.No. : IMMT-839H
Product Overview : Recombinant Human IMMT(481 a.a. - 580 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 481-580 a.a.
Description : Mitochondrial inner membrane protein is a protein that in humans is encoded by the IMMT gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : TQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQS HAVAEEEARKAHQLWLSVEALKYSM
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name IMMT inner membrane protein, mitochondrial [ Homo sapiens ]
Official Symbol IMMT
Synonyms IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653;
Gene ID 10989
mRNA Refseq NM_006839
Protein Refseq NP_006830
MIM 600378
UniProt ID Q16891
Chromosome Location 2p11.2
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IMMT Products

Required fields are marked with *

My Review for All IMMT Products

Required fields are marked with *

0
cart-icon