Recombinant Human IMMT Protein, GST-tagged
| Cat.No. : | IMMT-225H |
| Product Overview : | Recombinant Human IMMT Protein was expressed in E. coli with GST tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15% glycerol. |
| Molecular Mass : | 61 kDa |
| AA Sequence : | ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK |
| Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Gene Name | IMMT inner membrane protein, mitochondrial [ Homo sapiens ] |
| Official Symbol | IMMT |
| Synonyms | IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653; |
| Gene ID | 10989 |
| mRNA Refseq | NM_001100169 |
| Protein Refseq | NP_001093639 |
| MIM | 600378 |
| UniProt ID | Q16891 |
| ◆ Recombinant Proteins | ||
| Immt-2438R | Recombinant Rat Immt Transmembrane protein, His-tagged | +Inquiry |
| IMMT-2710R | Recombinant Rat IMMT Protein, His (Fc)-Avi-tagged | +Inquiry |
| IMMT-3054R | Recombinant Rat IMMT Protein | +Inquiry |
| IMMT-1601C | Recombinant Chicken IMMT | +Inquiry |
| RFL14194MF | Recombinant Full Length Mouse Mitochondrial Inner Membrane Protein(Immt) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IMMT-5216HCL | Recombinant Human IMMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMMT Products
Required fields are marked with *
My Review for All IMMT Products
Required fields are marked with *
