Recombinant Human IMMT Protein, GST-tagged
Cat.No. : | IMMT-225H |
Product Overview : | Recombinant Human IMMT Protein was expressed in E. coli with GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Form : | The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15% glycerol. |
Molecular Mass : | 61 kDa |
AA Sequence : | ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK |
Storage : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Gene Name | IMMT inner membrane protein, mitochondrial [ Homo sapiens ] |
Official Symbol | IMMT |
Synonyms | IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653; |
Gene ID | 10989 |
mRNA Refseq | NM_001100169 |
Protein Refseq | NP_001093639 |
MIM | 600378 |
UniProt ID | Q16891 |
◆ Recombinant Proteins | ||
IMMT-839H | Recombinant Human IMMT protein, GST-tagged | +Inquiry |
IMMT-3054R | Recombinant Rat IMMT Protein | +Inquiry |
IMMT-016H | Recombinant Human inner membrane protein, mitochondrial Protein, His tagged | +Inquiry |
IMMT-4530M | Recombinant Mouse IMMT Protein, His (Fc)-Avi-tagged | +Inquiry |
IMMT-30241TH | Recombinant Human IMMT, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IMMT-5216HCL | Recombinant Human IMMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IMMT Products
Required fields are marked with *
My Review for All IMMT Products
Required fields are marked with *