Recombinant Human IMMT Protein, GST-tagged

• Cat.No.: IMMT-225H
• Product Overview: Recombinant Human IMMT Protein was expressed in E. coli with GST tag.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Form: The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15% glycerol.
• Molecular Mass: 61 kDa
• AA Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK
• Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.

Gene Information

• Gene Name: IMMT inner membrane protein, mitochondrial [ Homo sapiens ]
• Official Symbol: IMMT
• Synonyms: IMMT; inner membrane protein, mitochondrial; inner membrane protein, mitochondrial (mitofilin); mitochondrial inner membrane protein; HMP; MINOS2; mitochondrial inner membrane organizing system 2; mitofilin; P87; P89; motor protein; proliferation-inducing gene 4; cell proliferation-inducing protein 52; cell proliferation-inducing gene 4/52 protein; PIG4; PIG52; P87/89; MGC111146; DKFZp779P1653
• Gene ID: 10989
• mRNA Refseq: NM_001100169
• Protein Refseq: NP_001093639
• MIM: 600378
• UniProt ID: Q16891