"UGCG" Related Products

Expand
Expand
Expand

Recombinant Human UGCG protein, GST-tagged

Cat.No.: UGCG-3581H
Product Overview: Recombinant Human UGCG(1 a.a. - 394 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: Glycosphingolipids (GSLs) are a group of membrane components that contain lipid and sugar moieties. They are present in essentially all animal cells and are believed to have important roles in various cellular processes. UDP-glucose ceramide glucosyltransferase catalyzes the first glycosylation step in glycosphingolipid biosynthesis. The product, glucosylceramide, is the core structure of more than 300 GSLs. UGCG is widely expressed and transciption is upregulated during keratinocyte differentiation.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 71.3 kDa
AA Sequence: MALLDLALEGMAVFGFVLFLVLWLMHFMAIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFE LDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLIWICDSGIRVI PDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGG LIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMTIYIFLSALWDPTISW RTGRYRLRCGGTAEEILDV
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: UGCG UDP-glucose ceramide glucosyltransferase [ Homo sapiens ]
Official Symbol: UGCG
Synonyms: UGCG; UDP-glucose ceramide glucosyltransferase; ceramide glucosyltransferase; GCS; glucosylceramide synthase; GLCT-1; UDP-glucose:N-acylsphingosine D-glucosyltransferase; GLCT1;
Gene ID: 7357
mRNA Refseq: NM_003358
Protein Refseq: NP_003349
MIM: 602874
UniProt ID: Q16739
Chromosome Location: 9q31
Pathway: Glycosphingolipid metabolism, organism-specific biosystem; IL2 signaling events mediated by PI3K, organism-specific biosystem; Lactosylceramide biosynthesis, organism-specific biosystem; Lactosylceramide biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem;
Function: ceramide glucosyltransferase activity; transferase activity, transferring glycosyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.