"CEBPA" Related Products

Expand

Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged

Cat. No.: CEBPA-94H
Product Overview: Recombinant HumanCEBP-α (residues 270-358) was purified by ion-exchange chromatography and FPLC gel-filtration chromatography. Recombinant Human CEBP-α His-Tag fusion proein produced in E.Coli is a single, non-glycosylated polypeptide chain containing amino acids 126 and having a molecular mass of 14.5 kDa
Description: CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBP α die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBP β causes defects in female reproduction.
Source: Escherichia Coli.
Amino Acid Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS RELDTLRGIF RQLPESSLVKAMGNCA
Physical Appearance: Sterile filtered clorless solution.
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by reducing and non-reducing SDS-PAGE Coomassie
Formulation: The protein (0.87mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
Applications: • ELISA • Inhibition Assays• Western Blotting
Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Gene Name: CEBPA CCAAT/enhancer binding protein (C/EBP), alpha [ Homo sapiens ]
Synonyms: CEBPA; C/EBP-alpha; CEBP; CCAAT/enhancer binding protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha
Gene ID: 1050
mRNA Refseq: NM_004364
Protein Refseq: NP_004355
MIM: 601626
UniProt ID: P49715
Chromosome Location: 19q13.1
Pathway: Acute myeloid leukemia; Pathways in cancer
Function: RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; sequence-specific DNA binding; transcription factor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.