| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
270-358 a.a. |
| Description : |
CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBP α die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBP β causes defects in female reproduction. |
| Amino Acid Sequence : |
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS RELDTLRGIF RQLPESSLVKAMGNCA |
| Physical Appearance : |
Sterile filtered clorless solution. |
| Purity : |
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by reducing and non-reducing SDS-PAGE Coomassie |
| Formulation : |
The protein (0.87mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol |
| Applications : |
• ELISA • Inhibition Assays• Western Blotting |
| Storage : |
Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
