Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged CEBPA-94H

Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged

Recombinant Human CCAAT/enhancer Binding Protein(C/EBP) α, His-tagged

CEBPA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : CEBPA-94H
Product Overview : Recombinant HumanCEBP-α (residues 270-358) was purified by ion-exchange chromatography and FPLC gel-filtration chromatography. Recombinant Human CEBP-α His-Tag fusion proein produced in E.Coli is a single, non-glycosylated polypeptide chain containing amino acids 126 and having a molecular mass of 14.5 kDa
Description : CCAAT/enhancer binding protein(C/EBP) α is a family of transcription factors that all contain a highly conserved, basic-leucine zipper domain at the C-terminus that is involved in dimerization and DNA binding. C/EBP family of transcription factors regulates viral and cellular CCAAT/enhancer element-mediated transcription. C/EBP family consist of several related proteins, C/EBP α, β, γ, δ, that form homodimers and that form heterodimers with each other. C/EBP proteins contain the bZIP region, which is characterized by two motifs in the C-terminal half of the protein; a basic region involved in DNA binding and a leucine zipper motif involved in dimerization. C/EBPs differ significantly in their physiological functions and in their downstream target genes. For example, mice lacking C/EBP α die shortly after birth due to severe hypoglycemia and the absence of glycogen storage in liver, whereas knockout of C/EBP β causes defects in female reproduction.
Source : Escherichia Coli.
Amino Acid Sequence : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLS RELDTLRGIF RQLPESSLVKAMGNCA
Physical Appearance : Sterile filtered clorless solution.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by reducing and non-reducing SDS-PAGE Coomassie
Formulation : The protein (0.87mg/ml) contains 20mM Tris-HCl pH7.5, 0.1M NaCl and 5mM β-Mercaptoethanol
Applications : • ELISA • Inhibition Assays• Western Blotting
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Avoid multiple freeze-thaw cycles. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
PDB rendering based on 1nqw. :

Gene Name : CEBPA CCAAT/enhancer binding protein (C/EBP), alpha [ Homo sapiens ]
Synonyms : CEBPA; C/EBP-alpha; CEBP; CCAAT/enhancer binding protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha
Gene ID : 1050
mRNA Refseq : NM_004364
Protein Refseq : NP_004355
MIM : 601626
UniProt ID : P49715
Chromosome Location : 19q13.1
Pathway : Acute myeloid leukemia; Pathways in cancer
Function : RNA polymerase II transcription factor activity, enhancer binding; protein dimerization activity; sequence-specific DNA binding; transcription factor binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy