Recombinant Human MB protein
Cat.No. : | MB-159H |
Product Overview : | Recombinant Human MB protein was expressed in E.coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 153 |
Description : | This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen. At least three alternatively spliced transcript variants encoding the same protein have been reported. |
Form : | Supplied as a 0.2μm filtered solution in 25 mM Tris-HCl, pH 8.0, with 50 % glycerol. |
Molecular Mass : | Approximately 17.1 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
AA Sequence : | GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG |
Endotoxin : | Less than 1.0 EU/μg of rHuMyoglobin as determined by LAL method. |
Purity : | >95% by SDS-PAGE. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | MB |
Official Symbol | MB |
Synonyms | MB; myoglobin; PVALB; MGC13548; |
Gene ID | 4151 |
mRNA Refseq | NM_005368 |
Protein Refseq | NP_005359 |
MIM | 160000 |
UniProt ID | P02144 |
◆ Recombinant Proteins | ||
MB-3257R | Recombinant Rat MB Protein, His (Fc)-Avi-tagged | +Inquiry |
Mb-5463M | Recombinant Mouse Mb protein, His&Myc-tagged | +Inquiry |
Mb-3977M | Recombinant Mouse Mb Protein, Myc/DDK-tagged | +Inquiry |
MB-25B | Active Native Bovine Myoglobin | +Inquiry |
MB-3090H | Recombinant Human MB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Mb-8229M | Native Mouse Myoglobin | +Inquiry |
MB-02B | Native Bovine MB Protein | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
MB-30275TH | Native Human MB | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *