Species : |
Human |
Source : |
HEK293 |
Tag : |
Fc |
Protein Length : |
1-328 a.a. |
Description : |
Interleukin 10 Receptor, Alpha, a member of the 'SIGN' family of C-type lectin receptors, is a type II membrane protein that is expressed on liver sinusoidal endothelial cells (LSEC), specialized capillary vessels that are involved in antigen presentation and hepatic immune surveillance. CD209L is also expressed by endothelial cells associated with lymph nodes and in the human lung on type II alveolar cells and endothelial cells. |
Amino Acid Sequence : |
HGTELPSPPSKLQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. |
Molecular Mass : |
Interleukin 10 Receptor, Alpha Chimera migrates as a broad band between 70 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. |
pI : |
Interleukin 10 Receptor, Alpha Chimera separates into a number of isoforms in 2D PAGE due to post-translational modifications, in particular glycosylation. The pI range is between 5.4 and 6.5. |
% Carbohydrate : |
Interleukin 10 Receptor, Alpha Chimera consists of 5-25% carbohydrate by weight. |
Glycosylation : |
Interleukin 10 Receptor, Alpha Chimera has N-linked and may have O-linked oligosaccharides. |
Purity : |
>95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : |
The product is supplied as a 200ug/ml solution in sterile phosphate-buffered saline. |
Storage : |
Short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |