"IL10RA" Related Products

Expand
Expand

Recombinant Human Interleukin 10 Receptor, Alpha, Fc Chimera

Cat. No.: IL10RA-492H
Product Overview: Recombinant Human interleukin 10 receptor, alpha encoding the signal peptide of IL-10 receptor alpha chain was fused to the extracellular domain of human CD209L (aa 1-328), which was in turn fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Interleukin 10 Receptor, Alpha, a member of the 'SIGN' family of C-type lectin receptors, is a type II membrane protein that is expressed on liver sinusoidal endothelial cells (LSEC), specialized capillary vessels that are involved in antigen presentation and hepatic immune surveillance. CD209L is also expressed by endothelial cells associated with lymph nodes and in the human lung on type II alveolar cells and endothelial cells.
Source: Human 293 cells.
Amino Acid Sequence: HGTELPSPPSKLQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Interleukin 10 Receptor, Alpha Chimera migrates as a broad band between 70 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation.
pI: Interleukin 10 Receptor, Alpha Chimera separates into a number of isoforms in 2D PAGE due to post-translational modifications, in particular glycosylation. The pI range is between 5.4 and 6.5.
% Carbohydrate: Interleukin 10 Receptor, Alpha Chimera consists of 5-25% carbohydrate by weight.
Glycosylation: Interleukin 10 Receptor, Alpha Chimera has N-linked and may have O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation: The product is supplied as a 200ug/ml solution in sterile phosphate-buffered saline.
Storage: Short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Gene Name: IL10RA interleukin 10 receptor, alpha [ Homo sapiens ]
Synonyms: IL10RA; interleukin 10 receptor, alpha; IL10R; CDW210A; HIL-10R; IL-10R1;Interleukin-10 receptor alpha chain;IL-10R-A; interleukin 10 receptor, alpha; CDw210a antigen
Gene ID: 3587
mRNA Refseq: NM_001558
Protein Refseq: NP_001549
UniProt ID: Q13651
Chromosome Location: 11q23
MIM: 146933
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway
Function: interleukin-10 receptor activity; protein binding; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.