| Species : |
Human |
| Source : |
Insect Cells |
| Tag : |
His |
| Protein Length : |
22-401aa |
| Description : |
The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. |
| Form : |
Liquid |
| Bio-activity : |
Measured by its ability to inhibit cytotoxicity using Jurkat human acute T cell leukemia cells in the presence of 2 ng/mL of human TRAIL. The ED50 range ≤ 8 ng/mL. |
| Molecular Mass : |
44.7 kDa |
| AA Sequence : |
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL |
| Endotoxin : |
<1 EU/μg by LAL |
| Purity : |
> 90% by SDS-PAGE |
| Applications : |
SDS-PAGE, Bioactivity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
| Reference : |
1. Lacey, D.L. et al. (1998) Cell 93:165-76
2. Yasuda H. et al. (1998) PNAS 95:3597-602
3. A. Van Campenhout, Golledge J. (2009) Atherosclerosis 204:321-29 |