"TNFSF9" Related Products

Expand
Expand

Recombinant Human TNFSF9 protein

Cat.No. : TNFSF9-924H
Product Overview : Recombinant Human TNFSF9 protein was expressed in Escherichia coli.
Description : 4-1BBL is a member of the tumor necrosis factor (TNF) receptor family. This receptor contributes to the clonal expansion, survival, and development of T cells. In addition, 4-1BBL expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. CD137 has been shown to interact with TRAF2. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain (ECD). The human 4­1BBL ECD shares 32 % and 35 % a.a. identity with murine and rat ECD.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by stimulation of IL-8 production using human PBMC is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg.
Molecular Mass : Approximately 19.4 kDa, a single non-glycosylated polypeptide chain containing 184 amino acids.
Protein length : 184
AA Sequence : REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Endotoxin : Less than 1 EU/µg of rHu4-1BBL as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : TNFSF9
Official Symbol : TNFSF9
Synonyms : TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L;
Gene ID : 8744
mRNA Refseq : NM_003811
Protein Refseq : NP_003802
MIM : 606182
UniProt ID : P41273

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.