"ABCD3" Related Products

Expand

Recombinant Human ABCD3

Cat.No.: ABCD3-30011TH
Product Overview: Recombinant fragment corresponding to amino acids 351-449 of Human PMP70 with an N terminal proprietary tag; Predicted MWt 36.52 kDa.
Description: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT
Sequence Similarities: Belongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.Contains 1 ABC transmembrane type-1 domain.Contains 1 ABC transporter domain.
Gene Name: ABCD3 ATP-binding cassette, sub-family D (ALD), member 3 [ Homo sapiens ]
Official Symbol: ABCD3
Synonyms: ABCD3; ATP-binding cassette, sub-family D (ALD), member 3; PXMP1; ATP-binding cassette sub-family D member 3; PMP70; ZWS2;
Gene ID: 5825
mRNA Refseq: NM_001122674
Protein Refseq: NP_001116146
Uniprot ID: P28288
Chromosome Location: 1p22-p21
Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; ABCA transporters in lipid homeostasis, organism-specific biosystem; Nuclear receptors in lipid metabolism and toxicity, organism-specific biosystem;
Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.