Recombinant Human ABCD3
Cat.No. : | ABCD3-30011TH |
Product Overview : | Recombinant fragment corresponding to amino acids 351-449 of Human PMP70 with an N terminal proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT |
Sequence Similarities : | Belongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.Contains 1 ABC transmembrane type-1 domain.Contains 1 ABC transporter domain. |
Gene Name | ABCD3 ATP-binding cassette, sub-family D (ALD), member 3 [ Homo sapiens ] |
Official Symbol | ABCD3 |
Synonyms | ABCD3; ATP-binding cassette, sub-family D (ALD), member 3; PXMP1; ATP-binding cassette sub-family D member 3; PMP70; ZWS2; |
Gene ID | 5825 |
mRNA Refseq | NM_001122674 |
Protein Refseq | NP_001116146 |
Uniprot ID | P28288 |
Chromosome Location | 1p22-p21 |
Pathway | ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; ABCA transporters in lipid homeostasis, organism-specific biosystem; Nuclear receptors in lipid metabolism and toxicity, organism-specific biosystem; |
Function | ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RFL-29291MF | Recombinant Full Length Mouse Atp-Binding Cassette Sub-Family D Member 3(Abcd3) Protein, His-Tagged | +Inquiry |
RFL-23022HF | Recombinant Full Length Human Atp-Binding Cassette Sub-Family D Member 3(Abcd3) Protein, His-Tagged | +Inquiry |
ABCD3-411R | Recombinant Rat ABCD3 Protein | +Inquiry |
ABCD3-1967C | Recombinant Chicken ABCD3 | +Inquiry |
ABCD3-9284H | Recombinant Human ABCD3 Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCD3 Products
Required fields are marked with *
My Review for All ABCD3 Products
Required fields are marked with *