Recombinant Human ABCD3

• Cat.No.: ABCD3-30011TH
• Product Overview: Recombinant fragment corresponding to amino acids 351-449 of Human PMP70 with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT
• Sequence Similarities: Belongs to the ABC transporter superfamily. ABCD family. Peroxisomal fatty acyl CoA transporter (TC 3.A.1.203) subfamily.Contains 1 ABC transmembrane type-1 domain.Contains 1 ABC transporter domain.

Gene Information

• Gene Name: ABCD3 ATP-binding cassette, sub-family D (ALD), member 3 [ Homo sapiens ]
• Official Symbol: ABCD3
• Synonyms: ABCD3; ATP-binding cassette, sub-family D (ALD), member 3; PXMP1; ATP-binding cassette sub-family D member 3; PMP70; ZWS2
• Gene ID: 5825
• mRNA Refseq: NM_001122674
• Protein Refseq: NP_001116146
• Uniprot ID: P28288
• Chromosome Location: 1p22-p21
• Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; ABCA transporters in lipid homeostasis, organism-specific biosystem; Nuclear receptors in lipid metabolism and toxicity, organism-specific biosystem
• Function: ATP binding; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; nucleotide binding; protein binding