Recombinant Human ACTL6B, His-tagged

Cat.No. : ACTL6B-26300TH
Product Overview : Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 5-282 a.a.
Description : The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV
Gene Name ACTL6B actin-like 6B [ Homo sapiens ]
Official Symbol ACTL6B
Synonyms ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B;
Gene ID 51412
mRNA Refseq NM_016188
Protein Refseq NP_057272
MIM 612458
Uniprot ID O94805
Chromosome Location 7q22
Function ATP binding; structural constituent of cytoskeleton; transcription coactivator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTL6B Products

Required fields are marked with *

My Review for All ACTL6B Products

Required fields are marked with *

0
cart-icon