Recombinant Human ACTL6B, His-tagged ACTL6B-26300TH

Specification
Gene Information
Related Products

Cat.No.:	ACTL6B-26300TH
Product Overview:	Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa;
Description:	The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain.
Conjugation:	HIS
Source:	E. coli
Form:	Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer:	Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage:	Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:	VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV

Download Datasheet

Gene Name:	ACTL6B actin-like 6B [ Homo sapiens ]
Official Symbol:	ACTL6B
Synonyms:	ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B;
Gene ID:	51412
mRNA Refseq:	NM_016188
Protein Refseq:	NP_057272
MIM:	612458
Uniprot ID:	O94805
Chromosome Location:	7q22
Function:	ATP binding; structural constituent of cytoskeleton; transcription coactivator activity;