"ACTL6B" Related Products

Expand
Expand

Recombinant Human ACTL6B, His-tagged

Cat.No. : ACTL6B-26300TH
Product Overview : Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa;
Description : The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 90 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV
Gene Name : ACTL6B actin-like 6B [ Homo sapiens ]
Official Symbol : ACTL6B
Synonyms : ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B;
Gene ID : 51412
mRNA Refseq : NM_016188
Protein Refseq : NP_057272
MIM : 612458
Uniprot ID : O94805
Chromosome Location : 7q22
Function : ATP binding; structural constituent of cytoskeleton; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.