Recombinant Human ACTL6B protein, GST-tagged

• Cat.No.: ACTL6B-301380H
• Product Overview: Recombinant Human ACTL6B (40-82 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Thr40-Met82
• AA Sequence: TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ACTL6B actin-like 6B [ Homo sapiens ]
• Official Symbol: ACTL6B
• Synonyms: ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6
• Gene ID: 51412
• mRNA Refseq: NM_016188
• Protein Refseq: NP_057272
• MIM: 612458
• UniProt ID: O94805