Recombinant Human ACTL6B protein, GST-tagged

Cat.No. : ACTL6B-301380H
Product Overview : Recombinant Human ACTL6B (40-82 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Thr40-Met82
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name ACTL6B actin-like 6B [ Homo sapiens ]
Official Symbol ACTL6B
Synonyms ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6;
Gene ID 51412
mRNA Refseq NM_016188
Protein Refseq NP_057272
MIM 612458
UniProt ID O94805

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACTL6B Products

Required fields are marked with *

My Review for All ACTL6B Products

Required fields are marked with *

0
cart-icon
0
compare icon