Recombinant Human ACTL6B protein, GST-tagged
Cat.No. : | ACTL6B-301380H |
Product Overview : | Recombinant Human ACTL6B (40-82 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr40-Met82 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ACTL6B actin-like 6B [ Homo sapiens ] |
Official Symbol | ACTL6B |
Synonyms | ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B; arpNalpha; hArpN alpha; actin-like 6; BRG1-associated factor 53B; actin-related protein Baf53b; 53 kDa BRG1-associated factor B; ACTL6; |
Gene ID | 51412 |
mRNA Refseq | NM_016188 |
Protein Refseq | NP_057272 |
MIM | 612458 |
UniProt ID | O94805 |
◆ Recombinant Proteins | ||
ACTL6B-1245M | Recombinant Mouse ACTL6B Protein | +Inquiry |
ACTL6B-223H | Recombinant Human ACTL6B Protein, GST-tagged | +Inquiry |
Actl6b-3101R | Recombinant Rat Actl6b, His-tagged | +Inquiry |
ACTL6B-223R | Recombinant Rhesus monkey ACTL6B Protein, His-tagged | +Inquiry |
ACTL6B-51R | Recombinant Rhesus Macaque ACTL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL6B-9060HCL | Recombinant Human ACTL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACTL6B Products
Required fields are marked with *
My Review for All ACTL6B Products
Required fields are marked with *
0
Inquiry Basket