Recombinant Human ADAM2
Cat.No. : | ADAM2-26137TH |
Product Overview : | Recombinant fragment of Human ADAM2 with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH |
Sequence Similarities : | Contains 1 disintegrin domain.Contains 1 EGF-like domain.Contains 1 peptidase M12B domain. |
Gene Name | ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ] |
Official Symbol | ADAM2 |
Synonyms | ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30; |
Gene ID | 2515 |
mRNA Refseq | NM_001464 |
Protein Refseq | NP_001455 |
MIM | 601533 |
Uniprot ID | Q99965 |
Chromosome Location | 8p11.2 |
Function | integrin binding; metalloendopeptidase activity; metallopeptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
ADAM2-26137TH | Recombinant Human ADAM2 | +Inquiry |
ADAM2-26413TH | Recombinant Human ADAM2 | +Inquiry |
ADAM2-871HF | Recombinant Full Length Human ADAM2 Protein, GST-tagged | +Inquiry |
ADAM2-11HF | Recombinant Full Length Human ADAM2 Protein | +Inquiry |
RFL-16767BF | Recombinant Full Length Bovine Disintegrin And Metalloproteinase Domain-Containing Protein 2(Adam2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM2-22HCL | Recombinant Human ADAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADAM2 Products
Required fields are marked with *
My Review for All ADAM2 Products
Required fields are marked with *