"ADAM2" Related Products

Expand

Recombinant Human ADAM2

Cat.No.: ADAM2-26137TH
Product Overview: Recombinant fragment of Human ADAM2 with N-terminal proprietary tag. Predicted MW 36.63 kDa.
Description: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed specifically in spermatogenic cells in the seminiferous cells. Not detected in fetal tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RLDPFFKQQAVCGNAKLEAGEECDCGTEQDCALIGETCCDIATCRFKAGSNCAEGPCCENCLFMSKERMCRPSFEECDLPEYCNGSSASCPENHYVQTGH
Sequence Similarities: Contains 1 disintegrin domain.Contains 1 EGF-like domain.Contains 1 peptidase M12B domain.
Gene Name: ADAM2 ADAM metallopeptidase domain 2 [ Homo sapiens ]
Official Symbol: ADAM2
Synonyms: ADAM2; ADAM metallopeptidase domain 2; fertilin beta , FTNB; disintegrin and metalloproteinase domain-containing protein 2; cancer/testis antigen 15; CT15; PH 30b; PH30;
Gene ID: 2515
mRNA Refseq: NM_001464
Protein Refseq: NP_001455
MIM: 601533
Uniprot ID: Q99965
Chromosome Location: 8p11.2
Function: integrin binding; metalloendopeptidase activity; metallopeptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.