Recombinant Human ADH1C

PRODUCTS

Home / Products / Antibody / Recombinant Human ADH1C

Recombinant Human ADH1C

ADH1C Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ADH1C-27094TH
Product Overview : Recombinant full length Human ADH1C with N terminal proprietary tag. Predicted MW 67.32 kDa.
Description : This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster.
Protein length : 375 amino acids
Molecular Weight : 67.320kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIK MVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAK IDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIF GGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF DLLRSGKSIRTVLTF
Sequence Similarities : Belongs to the zinc-containing alcohol dehydrogenase family.
Gene Name : ADH1C alcohol dehydrogenase 1C (class I), gamma polypeptide [ Homo sapiens ]
Official Symbol : ADH1C
Synonyms : ADH1C; alcohol dehydrogenase 1C (class I), gamma polypeptide; ADH3; alcohol dehydrogenase 1C;
Gene ID : 126
mRNA Refseq : NM_000669
Protein Refseq : NP_000660
MIM : 103730
Uniprot ID : P00326
Chromosome Location : 4q23
Pathway : Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem;
Function : alcohol dehydrogenase (NAD) activity; metal ion binding; nucleotide binding; oxidoreductase activity; zinc ion binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.