Recombinant Human ADH1C
Cat.No. : | ADH1C-27094TH |
Product Overview : | Recombinant full length Human ADH1C with N terminal proprietary tag. Predicted MW 67.32 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. |
Protein length : | 375 amino acids |
Molecular Weight : | 67.320kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIK MVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAK IDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIF GGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF DLLRSGKSIRTVLTF |
Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. |
Gene Name : | ADH1C alcohol dehydrogenase 1C (class I), gamma polypeptide [ Homo sapiens ] |
Official Symbol : | ADH1C |
Synonyms : | ADH1C; alcohol dehydrogenase 1C (class I), gamma polypeptide; ADH3; alcohol dehydrogenase 1C; |
Gene ID : | 126 |
mRNA Refseq : | NM_000669 |
Protein Refseq : | NP_000660 |
MIM : | 103730 |
Uniprot ID : | P00326 |
Chromosome Location : | 4q23 |
Pathway : | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; |
Function : | alcohol dehydrogenase (NAD) activity; metal ion binding; nucleotide binding; oxidoreductase activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
ADH1C-179R | Recombinant Rat ADH1C Protein, His (Fc)-Avi-tagged | +Inquiry |
ADH1C-0055H | Recombinant Human ADH1C Protein (S2-F375), Tag Free | +Inquiry |
ADH1C-77H | Recombinant Human ADH1C Protein, His&GST-tagged | +Inquiry |
ADH1C-100H | Recombinant Human ADH1C Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADH1C-0056H | Recombinant Human ADH1C Protein (S2-F375), His tagged | +Inquiry |
◆ Lysates | ||
ADH1C-9013HCL | Recombinant Human ADH1C 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionThe structural features of ADH1C, such as its active site and binding domains, are critical for its enzymatic activity and substrate recognition, enabling efficient alcohol oxidation.
Pharmacological agents or environmental factors can modulate ADH1C expression or activity, potentially influencing alcohol metabolism and providing avenues for therapeutic interventions or personalized medicine.
ADH1C has the capacity to metabolize other substrates beyond alcohol, suggesting its involvement in broader metabolic pathways and potential metabolic interactions.
Genetic variations or polymorphisms in the ADH1C gene have been associated with differences in alcohol metabolism and susceptibility to alcohol-related disorders, highlighting the impact of genotype on phenotype.
ADH1C expression or activity may vary among different species or populations, influenced by genetic and environmental factors, contributing to inter-individual or inter-species differences in alcohol metabolism and tolerance.
ADH1C exhibits a tissue-specific expression pattern, with higher expression levels in certain organs such as the liver, and its distribution may differ from other ADH isoforms, reflecting functional specialization.
ADH1C plays a significant role in alcohol metabolism, showing specific catalytic efficiency and substrate specificity for the conversion of alcohol to acetaldehyde.
The expression of ADH1C is regulated by specific mechanisms, including transcriptional and post-transcriptional regulation, which can respond to alcohol exposure or metabolic factors such as hormonal signaling.
There may be interacting proteins or partners of ADH1C that influence its function or localization, potentially modulating its enzymatic activity or cellular processes.
ADH1C deficiency or knockout in experimental models leads to altered alcohol metabolism and related phenotypes, such as decreased alcohol clearance and increased sensitivity to alcohol-induced effects.
Customer Reviews (2)
Write a reviewHighly specific in recognizing and cleaving target substrates in protease assays.
Provides efficient and accurate quantification of post-translational modifications in PTM studies.
Ask a Question for All ADH1C Products
Required fields are marked with *
My Review for All ADH1C Products
Required fields are marked with *
Inquiry Basket