Recombinant Human ADH1C
Cat.No. : | ADH1C-27094TH |
Product Overview : | Recombinant full length Human ADH1C with N terminal proprietary tag. Predicted MW 67.32 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 375 amino acids |
Description : | This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. |
Molecular Weight : | 67.320kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIK MVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAK IDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIF GGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF DLLRSGKSIRTVLTF |
Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. |
Gene Name | ADH1C alcohol dehydrogenase 1C (class I), gamma polypeptide [ Homo sapiens ] |
Official Symbol | ADH1C |
Synonyms | ADH1C; alcohol dehydrogenase 1C (class I), gamma polypeptide; ADH3; alcohol dehydrogenase 1C; |
Gene ID | 126 |
mRNA Refseq | NM_000669 |
Protein Refseq | NP_000660 |
MIM | 103730 |
Uniprot ID | P00326 |
Chromosome Location | 4q23 |
Pathway | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; |
Function | alcohol dehydrogenase (NAD) activity; metal ion binding; nucleotide binding; oxidoreductase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
ADH1C-523R | Recombinant Rat ADH1C Protein | +Inquiry |
ADH1C-346H | Recombinant Human ADH1C Protein, GST-tagged | +Inquiry |
ADH1C-09HF | Recombinant Full Length Human ADH1C Protein | +Inquiry |
ADH1C-9418H | Recombinant Human ADH1C, His-tagged | +Inquiry |
ADH1C-0055H | Recombinant Human ADH1C Protein (S2-F375), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADH1C-9013HCL | Recombinant Human ADH1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH1C Products
Required fields are marked with *
My Review for All ADH1C Products
Required fields are marked with *
0
Inquiry Basket