Recombinant Human ADH1C
| Cat.No. : | ADH1C-27094TH | 
| Product Overview : | Recombinant full length Human ADH1C with N terminal proprietary tag. Predicted MW 67.32 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 375 amino acids | 
| Description : | This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. | 
| Molecular Weight : | 67.320kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIK MVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEG VTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAK IDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFG LGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIF GGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF DLLRSGKSIRTVLTF | 
| Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. | 
| Gene Name | ADH1C alcohol dehydrogenase 1C (class I), gamma polypeptide [ Homo sapiens ] | 
| Official Symbol | ADH1C | 
| Synonyms | ADH1C; alcohol dehydrogenase 1C (class I), gamma polypeptide; ADH3; alcohol dehydrogenase 1C; | 
| Gene ID | 126 | 
| mRNA Refseq | NM_000669 | 
| Protein Refseq | NP_000660 | 
| MIM | 103730 | 
| Uniprot ID | P00326 | 
| Chromosome Location | 4q23 | 
| Pathway | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem; | 
| Function | alcohol dehydrogenase (NAD) activity; metal ion binding; nucleotide binding; oxidoreductase activity; zinc ion binding; | 
| ◆ Recombinant Proteins | ||
| ADH1C-0055H | Recombinant Human ADH1C Protein (S2-F375), Tag Free | +Inquiry | 
| ADH1C-925HF | Recombinant Full Length Human ADH1C Protein, GST-tagged | +Inquiry | 
| ADH1C-9418H | Recombinant Human ADH1C, His-tagged | +Inquiry | 
| ADH1C-2487H | Recombinant Human ADH1C protein, GST-tagged | +Inquiry | 
| ADH1C-77H | Recombinant Human ADH1C Protein, His&GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ADH1C-9013HCL | Recombinant Human ADH1C 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ADH1C Products
Required fields are marked with *
My Review for All ADH1C Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            